Product Number |
ARP35263_P050 |
Product Page |
www.avivasysbio.com/clic5-antibody-c-terminal-region-arp35263-p050.html |
Name |
CLIC5 Antibody - C-terminal region (ARP35263_P050) |
Protein Size (# AA) |
251 amino acids |
Molecular Weight |
28 kDa |
NCBI Gene Id |
53405 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Chloride intracellular channel 5 |
Description |
|
Alias Symbols |
MST130, DFNB102, DFNB103, MSTP130 |
Peptide Sequence |
Synthetic peptide located within the following region: YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Berryman,M., et al., (2004) J. Biol. Chem. 279 (33), 34794-34801 |
Description of Target |
Chloride intracellular channels are involved in chloride ion transport within various subcellular compartments. CLIon Channel5 specifically associates with the cytoskeleton of placenta microvilli. |
Protein Interactions |
SRPK1; FN1; IQGAP1; GSN; EZR; ACTA1; ACTN1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
|
Datasheets/Manuals |
Printable datasheet for anti-CLIC5 (ARP35263_P050) antibody |
Blocking Peptide |
For anti-CLIC5 (ARP35263_P050) antibody is Catalog # AAP35263 (Previous Catalog # AAPP06501) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CLIC5 |
Uniprot ID |
Q53G01 |
Protein Name |
Chloride intracellular channel 5 variant EMBL BAD96850.1 |
Publications |
The chloride intracellular channel 5A stimulates podocyte Rac1, protecting against hypertension-induced glomerular injury. Kidney Int. 89, 833-47 (2016). 26924049 |
Sample Type Confirmation |
There is BioGPS gene expression data showing that CLIC5 is expressed in Jurkat |
Protein Accession # |
NP_058625 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_016929 |
Tested Species Reactivity |
Human |
Gene Symbol |
CLIC5 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 92% |
Image 1 | Human Heart
| Human Heart |
|
Image 2 | Human Jurkat
| WB Suggested Anti-CLIC5 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that CLIC5 is expressed in Jurkat |
|