| Product Number |
ARP35259_T100 |
| Product Page |
www.avivasysbio.com/p2rx2-antibody-middle-region-arp35259-t100.html |
| Name |
P2RX2 Antibody - middle region (ARP35259_T100) |
| Protein Size (# AA) |
379 amino acids |
| Molecular Weight |
42kDa |
| NCBI Gene Id |
22953 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Purinergic receptor P2X, ligand-gated ion channel, 2 |
| Alias Symbols |
P2X2, DFNA41 |
| Peptide Sequence |
Synthetic peptide located within the following region: LIKNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Barrera,N.P., et al., (2005) J. Biol. Chem. 280 (11), 10759-10765 |
| Description of Target |
P2RX2 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Six transcript variants encoding six distinct isoforms have been identified for this gene. |
| Protein Interactions |
P2RX2; GABRR1; P2RX3; P2RX1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-P2RX2 (ARP35259_T100) antibody |
| Blocking Peptide |
For anti-P2RX2 (ARP35259_T100) antibody is Catalog # AAP35259 (Previous Catalog # AAPP06493) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human P2RX2 |
| Uniprot ID |
Q9UBL9-5 |
| Protein Name |
P2X purinoceptor 2 |
| Protein Accession # |
NP_777361 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_174872 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
P2RX2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 77%; Dog: 77%; Guinea Pig: 85%; Horse: 77%; Human: 100%; Mouse: 91%; Rabbit: 85%; Rat: 91% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-P2RX2 Antibody Titration: 0.6ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate |
|
| Image 2 | Human kidney
 | Human kidney |
|
| Image 3 | Mouse Spleen, Mouse Kidney
 | Host: Rabbit
Target: P2RX2
Positive control (+): Mouse Spleen (M-SP)
Negative control (-): Mouse Kidney (M-KI)
Antibody concentration: 1ug/ml |
|
