| Product Number |
ARP35258_P050 |
| Product Page |
www.avivasysbio.com/p2rx2-antibody-n-terminal-region-arp35258-p050.html |
| Name |
P2RX2 Antibody - N-terminal region (ARP35258_P050) |
| Protein Size (# AA) |
471 amino acids |
| Molecular Weight |
52kDa |
| NCBI Gene Id |
22953 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Purinergic receptor P2X, ligand-gated ion channel, 2 |
| Alias Symbols |
P2X2, DFNA41 |
| Peptide Sequence |
Synthetic peptide located within the following region: YFVWYVFIVQKSYQESETGPESSIITKVKGITTSEHKVWDVEEYVKPPEG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Aschrafi,A., et al., (2004) J. Mol. Biol. 342 (1), 333-343 |
| Description of Target |
The product of P2RX2 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. |
| Protein Interactions |
P2RX2; GABRR1; P2RX3; P2RX1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-P2RX2 (ARP35258_P050) antibody |
| Blocking Peptide |
For anti-P2RX2 (ARP35258_P050) antibody is Catalog # AAP35258 (Previous Catalog # AAPP06492) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human P2RX2 |
| Uniprot ID |
Q9UBL9 |
| Protein Name |
P2X purinoceptor 2 |
| Protein Accession # |
NP_733782 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_170682 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
P2RX2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
| Image 1 | Mouse Intestine, Rat Liver
 | Host: Rabbit
Target: P2RX2
Positive control (+): Mouse Intestine (M-IN)
Negative control (-): Rat Liver (R-LI)
Antibody concentration: 0.5ug/ml |
|
| Image 2 | Human 293T Whole Cell
 | Host: Rabbit
Target Name: P2RX2
Sample Tissue: Human 293T Whole Cell
Antibody Dilution: 1ug/ml |
|
| Image 3 | Human Jurkat
 | WB Suggested Anti-P2RX2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:2500
Positive Control: Jurkat cell lysate |
|
