| Product Number |
ARP35246_T100 |
| Product Page |
www.avivasysbio.com/kcnip1-antibody-n-terminal-region-arp35246-t100.html |
| Name |
KCNIP1 Antibody - N-terminal region (ARP35246_T100) |
| Protein Size (# AA) |
216 amino acids |
| Molecular Weight |
25kDa |
| NCBI Gene Id |
30820 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Kv channel interacting protein 1 |
| Alias Symbols |
VABP, KCHIP1 |
| Peptide Sequence |
Synthetic peptide located within the following region: FSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Pruunsild,P., et al., (2005) Genomics 86 (5), 581-593 |
| Description of Target |
KCNIP1 is a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Alternative splicing results in multiple transcript variant encoding different isoforms. |
| Protein Interactions |
KCNIP2; KCND2; SPP1; KCND1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-KCNIP1 (ARP35246_T100) antibody |
| Blocking Peptide |
For anti-KCNIP1 (ARP35246_T100) antibody is Catalog # AAP35246 (Previous Catalog # AAPP06480) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human KCNIP1 |
| Uniprot ID |
Q9NZI2-2 |
| Protein Name |
Kv channel-interacting protein 1 |
| Protein Accession # |
NP_055407 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_014592 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
KCNIP1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
| Image 1 | Human Brain
 | Human Brain |
| | Image 2 | Human Jurkat
 | WB Suggested Anti-KCNIP1 Antibody Titration: 1.35ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate |
|
|
