CLIC4 Antibody - N-terminal region (ARP35222_T100)

Data Sheet
 
Product Number ARP35222_T100
Product Page www.avivasysbio.com/clic4-antibody-n-terminal-region-arp35222-t100.html
Name CLIC4 Antibody - N-terminal region (ARP35222_T100)
Protein Size (# AA) 253 amino acids
Molecular Weight 28kDa
NCBI Gene Id 25932
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Chloride intracellular channel 4
Alias Symbols H1, huH1, p64H1, CLIC4L, MTCLIC
Peptide Sequence Synthetic peptide located within the following region: LSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Shiio,Y., et al., (2006) J. Biol. Chem. 281 (5), 2750-2756
Description of Target Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIon Channel4) protein, encoded by the CLIon Channel4 gene, is a member of the p64 family; the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells).
Protein Interactions UBC; SUMO2; GRDX; REL; HSP90AB1; HNRNPA1; SPRTN; CDK2; DNM1; YWHAZ; ACTB;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CLIC4 (ARP35222_T100) antibody
Blocking Peptide For anti-CLIC4 (ARP35222_T100) antibody is Catalog # AAP35222 (Previous Catalog # AAPP06456)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CLIC4
Uniprot ID Q5VSX5
Protein Accession # NP_039234
Purification Protein A purified
Nucleotide Accession # NM_013943
Tested Species Reactivity Human
Gene Symbol CLIC4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 92%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 82%
Image 1
Human Jurkat
WB Suggested Anti-CLIC4 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com