Product Number |
ARP35222_T100 |
Product Page |
www.avivasysbio.com/clic4-antibody-n-terminal-region-arp35222-t100.html |
Name |
CLIC4 Antibody - N-terminal region (ARP35222_T100) |
Protein Size (# AA) |
253 amino acids |
Molecular Weight |
28kDa |
NCBI Gene Id |
25932 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Chloride intracellular channel 4 |
Alias Symbols |
H1, huH1, p64H1, CLIC4L, MTCLIC |
Peptide Sequence |
Synthetic peptide located within the following region: LSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVF |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Shiio,Y., et al., (2006) J. Biol. Chem. 281 (5), 2750-2756 |
Description of Target |
Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIon Channel4) protein, encoded by the CLIon Channel4 gene, is a member of the p64 family; the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells). |
Protein Interactions |
UBC; SUMO2; GRDX; REL; HSP90AB1; HNRNPA1; SPRTN; CDK2; DNM1; YWHAZ; ACTB; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CLIC4 (ARP35222_T100) antibody |
Blocking Peptide |
For anti-CLIC4 (ARP35222_T100) antibody is Catalog # AAP35222 (Previous Catalog # AAPP06456) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CLIC4 |
Uniprot ID |
Q5VSX5 |
Protein Accession # |
NP_039234 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_013943 |
Tested Species Reactivity |
Human |
Gene Symbol |
CLIC4 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 92%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 82% |
Image 1 | Human Jurkat
| WB Suggested Anti-CLIC4 Antibody Titration: 2.5ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysate |
|