KCND3 Antibody - middle region (ARP35165_T100)

• Product Number: ARP35165_T100
• Name: KCND3 Antibody - middle region (ARP35165_T100)
• Protein Size (# AA): 636 amino acids
• Molecular Weight: 70kDa
• NCBI Gene Id: 3752
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Potassium voltage-gated channel, Shal-related subfamily, member 3
• Alias Symbols: KV4.3, SCA19, SCA22, BRGDA9, KCND3L, KCND3S, KSHIVB
• Peptide Sequence: Synthetic peptide located within the following region: KARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Hatano,N., et al., (2004) J. Biol. Chem. 279 (7), 5450-5459
• Description of Target: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). KCND3 encodes a member of the potassium channel, voltage-gated, shal-related subfamily, members of which form voltage-activated A-type potassium ion channels and are prominent in the repolarization phase of the action potential.
• Protein Interactions: NDUFS2; NAP1L1; LBR; HSPA8; HSPA5; HNRNPF; XRCC6; EWSR1; EMD; DDB1; CUX1; CDK1; AUP1; NONO; XRCC5; UQCRC2; TUBB2A; RCN2; Rapgef5; Rapgef4; Kcnip1; Rapgef3; Kcnip2; DPP10; PYCR2; VPS4A; TUBA1B; G3BP1; RUVBL1; CNBP; SRC; KCND3;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-KCND3 (ARP35165_T100) antibody is Catalog # AAP35165 (Previous Catalog # AAPP06396)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KCND3
• Uniprot ID: Q9UK17-2
• Protein Name: Potassium voltage-gated channel subfamily D member 3
• Protein Accession #: NP_751948
• Purification: Protein A purified
• Nucleotide Accession #: NM_172198
• Tested Species Reactivity: Human, Rat
• Gene Symbol: KCND3
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 92%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-KCND3 Antibody Titration: 1.25ug/ml
  ELISA Titer: 1:12500
  Positive Control: HepG2 cell lysate
• Image 2: Rat Liver
  
  Host: Rat
  Target Name: KCND3
  Sample Tissue: Rat Liver
  Antibody Dilution: 1ug/ml