Product Number |
ARP35151_T100 |
Product Page |
www.avivasysbio.com/kcnab3-antibody-n-terminal-region-arp35151-t100.html |
Name |
KCNAB3 Antibody - N-terminal region (ARP35151_T100) |
Protein Size (# AA) |
404 amino acids |
Molecular Weight |
44kDa |
Subunit |
beta-3 |
NCBI Gene Id |
9196 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Potassium voltage-gated channel, shaker-related subfamily, beta member 3 |
Alias Symbols |
AKR6A9, KCNA3B, KCNA3.1B, KV-BETA-3 |
Peptide Sequence |
Synthetic peptide located within the following region: RNLGKSGLRVSCLGLGTWVTFGSQISDETAEDVLTVAYEHGVNLFDTAEV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Leicher,T., et al., (1998) J. Biol. Chem. 273 (52), 35095-35101 |
Description of Target |
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member and the KCNA5 gene product assemble into a heteromultimeric A-type channel that inactivates completely and is significantly faster than other A-type Kv channels. |
Protein Interactions |
APP; UBC; NEDD4L; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-KCNAB3 (ARP35151_T100) antibody |
Blocking Peptide |
For anti-KCNAB3 (ARP35151_T100) antibody is Catalog # AAP35151 (Previous Catalog # AAPP06381) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human KCNAB3 |
Uniprot ID |
O43448 |
Protein Name |
Voltage-gated potassium channel subunit beta-3 |
Protein Accession # |
NP_004723 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_004732 |
Tested Species Reactivity |
Human |
Gene Symbol |
KCNAB3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100% |
Image 1 | Human kidney
| Human kidney |
|
Image 2 | Human Jurkat
| WB Suggested Anti-KCNAB3 Antibody Titration: 0.65ug/ml ELISA Titer: 1:12500 Positive Control: Jurkat cell lysate |
|