KCNAB3 Antibody - N-terminal region (ARP35151_T100)

Data Sheet
 
Product Number ARP35151_T100
Product Page www.avivasysbio.com/kcnab3-antibody-n-terminal-region-arp35151-t100.html
Name KCNAB3 Antibody - N-terminal region (ARP35151_T100)
Protein Size (# AA) 404 amino acids
Molecular Weight 44kDa
Subunit beta-3
NCBI Gene Id 9196
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Potassium voltage-gated channel, shaker-related subfamily, beta member 3
Alias Symbols AKR6A9, KCNA3B, KCNA3.1B, KV-BETA-3
Peptide Sequence Synthetic peptide located within the following region: RNLGKSGLRVSCLGLGTWVTFGSQISDETAEDVLTVAYEHGVNLFDTAEV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Leicher,T., et al., (1998) J. Biol. Chem. 273 (52), 35095-35101
Description of Target Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member and the KCNA5 gene product assemble into a heteromultimeric A-type channel that inactivates completely and is significantly faster than other A-type Kv channels.
Protein Interactions APP; UBC; NEDD4L;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KCNAB3 (ARP35151_T100) antibody
Blocking Peptide For anti-KCNAB3 (ARP35151_T100) antibody is Catalog # AAP35151 (Previous Catalog # AAPP06381)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human KCNAB3
Uniprot ID O43448
Protein Name Voltage-gated potassium channel subunit beta-3
Protein Accession # NP_004723
Purification Protein A purified
Nucleotide Accession # NM_004732
Tested Species Reactivity Human
Gene Symbol KCNAB3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Image 1
Human kidney
Human kidney
Image 2
Human Jurkat
WB Suggested Anti-KCNAB3 Antibody Titration: 0.65ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com