KCNAB1 Antibody - C-terminal region (ARP35126_P050)

Data Sheet
 
Product Number ARP35126_P050
Product Page www.avivasysbio.com/kcnab1-antibody-c-terminal-region-arp35126-p050.html
Name KCNAB1 Antibody - C-terminal region (ARP35126_P050)
Protein Size (# AA) 419 amino acids
Molecular Weight 46kDa
Subunit beta-1
NCBI Gene Id 7881
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Potassium voltage-gated channel, shaker-related subfamily, beta member 1
Alias Symbols hKvb3, AKR6A3, KCNA1B, Kvb1.3, hKvBeta3, KV-BETA-1
Peptide Sequence Synthetic peptide located within the following region: VPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Suzuki,Y., et al., (2000) Genomics 64 (3), 286-297
Description of Target Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. The KCNAB1 gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily.
Protein Interactions SRPK1; APP; GNB2L1; KCNA5; ARRB2; ELAVL1; Nedd4; NEDD4L; SLC39A2; SLC39A1; DLG1; KCNA2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KCNAB1 (ARP35126_P050) antibody
Blocking Peptide For anti-KCNAB1 (ARP35126_P050) antibody is Catalog # AAP35126 (Previous Catalog # AAPP06357)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human KCNAB1
Uniprot ID Q14722
Protein Name Voltage-gated potassium channel subunit beta-1
Protein Accession # NP_751892
Purification Affinity Purified
Nucleotide Accession # NM_172160
Tested Species Reactivity Human, Mouse
Gene Symbol KCNAB1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Image 1
Human kidney
WB Suggested Anti-KCNAB1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human kidney
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com