Product Number |
ARP35126_P050 |
Product Page |
www.avivasysbio.com/kcnab1-antibody-c-terminal-region-arp35126-p050.html |
Name |
KCNAB1 Antibody - C-terminal region (ARP35126_P050) |
Protein Size (# AA) |
419 amino acids |
Molecular Weight |
46kDa |
Subunit |
beta-1 |
NCBI Gene Id |
7881 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Potassium voltage-gated channel, shaker-related subfamily, beta member 1 |
Alias Symbols |
hKvb3, AKR6A3, KCNA1B, Kvb1.3, hKvBeta3, KV-BETA-1 |
Peptide Sequence |
Synthetic peptide located within the following region: VPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Suzuki,Y., et al., (2000) Genomics 64 (3), 286-297 |
Description of Target |
Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. The KCNAB1 gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. |
Protein Interactions |
SRPK1; APP; GNB2L1; KCNA5; ARRB2; ELAVL1; Nedd4; NEDD4L; SLC39A2; SLC39A1; DLG1; KCNA2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-KCNAB1 (ARP35126_P050) antibody |
Blocking Peptide |
For anti-KCNAB1 (ARP35126_P050) antibody is Catalog # AAP35126 (Previous Catalog # AAPP06357) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human KCNAB1 |
Uniprot ID |
Q14722 |
Protein Name |
Voltage-gated potassium channel subunit beta-1 |
Protein Accession # |
NP_751892 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_172160 |
Tested Species Reactivity |
Human, Mouse |
Gene Symbol |
KCNAB1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77% |
Image 1 | Human kidney
| WB Suggested Anti-KCNAB1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human kidney |
|