VDAC1 Antibody - C-terminal region (ARP35122_T100)

Data Sheet
 
Product Number ARP35122_T100
Product Page www.avivasysbio.com/vdac1-antibody-c-terminal-region-arp35122-t100.html
Name VDAC1 Antibody - C-terminal region (ARP35122_T100)
Protein Size (# AA) 283 amino acids
Molecular Weight 31kDa
NCBI Gene Id 7416
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Voltage-dependent anion channel 1
Alias Symbols PORIN, VDAC-1
Peptide Sequence Synthetic peptide located within the following region: SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Zheng,Y., et al., (2004) Oncogene 23 (6), 1239-1247
Description of Target The voltage-dependent anion-selective channel 1 (VDAC1) functions as a channel in membranous structures for the outer mitochondrial membrane, the cell membrane, endosomes, caveolae, the sarcoplasmatic reticulum, synaptosomes, and post-synaptic density fraction. A major function of VDAC1 in the plasma membrane is that of a NADH(-ferricyanide) reductase that may be involved in the maintenance of cellular redox homeostasis.
Protein Interactions UBC; KLHL40; SPRTN; MDM2; ADRB2; ASB14; ASB17; PARK2; BAG3; env; VCAM1; HK1; ATF2; FMNL1; TUBA1B; MDC1; CAV1; Htt; SFXN3; SUGP1; UBAP2; UFM1; ACAD9; MGAT4B; ACAA2; ZMPSTE24; VAPA; ALDH5A1; SF1; VDAC3; VDAC2; UBA52; TIAL1; FLOT2; CDK2; SIRT7; SUMO4; MAPK3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-VDAC1 (ARP35122_T100) antibody
Blocking Peptide For anti-VDAC1 (ARP35122_T100) antibody is Catalog # AAP35122 (Previous Catalog # AAPP06353)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human VDAC1
Uniprot ID Q5FVE7
Protein Name Voltage-dependent anion-selective channel protein 1
Publications

Arduíno, D. M. et al. Mitochondrial metabolism in Parkinson’s disease impairs quality control autophagy by hampering microtubule-dependent traffic. Hum. Mol. Genet. 21, 4680-702 (2012). 22843496

Chen, S. et al. Reduced expression of lamin A/C results in modified cell signaling and metabolism coupled with changes in expression of structural proteins. J. Proteome Res. 8, 5196-211 (2009). 19775189

Rousset, F., Nguyen, M. V. C., Grange, L., Morel, F. & Lardy, B. Heme oxygenase-1 regulates matrix metalloproteinase MMP-1 secretion and chondrocyte cell death via Nox4 NADPH oxidase activity in chondrocytes. PLoS One 8, e66478 (2013). 23840483

Sample Type Confirmation

VDAC1 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_003365
Purification Protein A purified
Nucleotide Accession # NM_003374
Tested Species Reactivity Human
Gene Symbol VDAC1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Image 1
Human HepG2
WB Suggested Anti-VDAC1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysateVDAC1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells
Image 2
Human Liver
Rabbit Anti-VDAC1 Antibody
Catalog Number: ARP35122
Paraffin Embedded Tissue: Human Liver
Cellular Data: Hepatocytes
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 3
Human Stomach Tumor, Human Lung
Host: Rabbit
Target: VDAC1
Positive control (+): Human Stomach Tumor (T-ST)
Negative control (-): Human Lung (LU)
Antibody concentration: 5ug/ml
Image 4
Hela, 293T, K562, MDA-MB-231
Lanes:
Lane 1: 50ug HeLa lysate
Lane 2: 50ug 293T lysate
Lane 3: 50ug K562 lysate
Lane 4: 50ug MDA-MB-231 lysate
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Anti-rabbit-HRP
Secondary Antibody Dilution:
1:1000
Gene Name:
VDAC1
Submitted by:
David Colecchia, Ph.D, Istituto Toscano Tumori, Core Research Laboratory, presso Fondazione Toscana Life Sciences
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com