P2RX1 Antibody - middle region (ARP35105_T100)

• Product Number: ARP35105_T100
• Name: P2RX1 Antibody - middle region (ARP35105_T100)
• Protein Size (# AA): 399 amino acids
• Molecular Weight: 45kDa
• NCBI Gene Id: 5023
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Purinergic receptor P2X, ligand-gated ion channel, 1
• Alias Symbols: P2X1
• Peptide Sequence: Synthetic peptide located within the following region: VVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVENG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Vial,C., (2006) Biochem. Biophys. Res. Commun. 343 (2), 415-419
• Description of Target: P2RX1 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel with relatively high calcium permeability. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle, being responsible, for example, for sympathetic vasoconstriction in small arteries, arterioles and vas deferens. Mouse studies suggest that this receptor is essential for normal male reproductive function. It is possible that the development of selective antagonists for this receptor may provide an effective non-hormonal male contraceptive pill.The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel with relatively high calcium permeability. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle, being responsible, for example, for sympathetic vasoconstriction in small arteries, arterioles and vas deferens. Mouse studies suggest that this receptor is essential for normal male reproductive function. It is possible that the development of selective antagonists for this receptor may provide an effective non-hormonal male contraceptive pill.
• Protein Interactions: P2RX2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-P2RX1 (ARP35105_T100) antibody is Catalog # AAP35105 (Previous Catalog # AAPP08959)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human P2RX1
• Uniprot ID: P51575
• Protein Name: P2X purinoceptor 1
• Protein Accession #: NP_002549
• Purification: Protein A purified
• Nucleotide Accession #: NM_002558
• Tested Species Reactivity: Human
• Gene Symbol: P2RX1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
• Image 1: Human Pancreas
  
  Human Pancreas
• Image 2: Human HepG2
  
  WB Suggested Anti-P2RX1 Antibody Titration: 2.5ug/ml
  ELISA Titer: 1:312500
  Positive Control: HepG2 cell lysate