KCNN2 Antibody - C-terminal region (ARP35094_T100)

Data Sheet
 
Product Number ARP35094_T100
Product Page www.avivasysbio.com/kcnn2-antibody-c-terminal-region-arp35094-t100.html
Name KCNN2 Antibody - C-terminal region (ARP35094_T100)
Protein Size (# AA) 579 amino acids
Molecular Weight 64kDa
NCBI Gene Id 3781
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2
Alias Symbols SK2, hSK2, SKCA2, KCa2.2, SKCa 2
Peptide Sequence Synthetic peptide located within the following region: IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Feranchak,A.P., et al., (2004) Gastroenterology 127 (3), 903-913
Description of Target Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. The protein encoded by KCNN2 is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. The encoded protein is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. KCNN2 is a member of the KCNN family of potassium channel genes.
Protein Interactions SRPK2; SRPK1; UBC; ACTN2; KCNN2; CALM1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KCNN2 (ARP35094_T100) antibody
Blocking Peptide For anti-KCNN2 (ARP35094_T100) antibody is Catalog # AAP35094 (Previous Catalog # AAPP06325)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human KCNN2
Uniprot ID Q9H2S1
Protein Name Small conductance calcium-activated potassium channel protein 2
Publications

Chakroborty, S. et al. Early presynaptic and postsynaptic calcium signaling abnormalities mask underlying synaptic depression in presymptomatic Alzheimer’s disease mice. J. Neurosci. 32, 8341-53 (2012). 22699914

Protein Accession # NP_067627
Purification Protein A purified
Nucleotide Accession # NM_021614
Tested Species Reactivity Human, Rat, Monkey
Gene Symbol KCNN2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish, Monkey
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Yeast: 100%; Zebrafish: 93%
Image 1
Rat brain section
Lanes:
Rat brain section
Primary Antibody Dilution:
1:500
Secondary Antibody:
Anti-rabbit-biotin, streptavidin-diaminobenzidine
Secondary Antibody Dilution:
1:500
Gene Name:
KCNN2
Submitted by:
Dr. Amiel Rosenkranz, Rosalind Franklin University
Image 2
Rhesus macaque spinal cord
Sample Type:
Rhesus macaque spinal cord
Primary Antibody Dilution:
1:300
Secondary Antibody:
Donkey anti Rabbit 488
Secondary Antibody Dilution:
1:500
Color/Signal Descriptions:
Green: KCNN2
Gene Name:
KCNN2
Submitted by:
Timur Mavlyutov, Ph. D., Department of Pharmacology, University of Wisconsin Medical School
Image 3
Human liver, 293T
Host: Rabbit
Target: KCNN2
Positive control (+): Human liver (LI)
Negative control (-): 293T (2T)
Antibody concentration: 0.5ug/ml
Image 4
Human Fetal Liver
Host: Rabbit
Target Name: KCNN2
Sample Tissue: Human Fetal Liver
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com