KCNK3 Antibody - C-terminal region (ARP35090_T100)

• Product Number: ARP35090_T100
• Name: KCNK3 Antibody - C-terminal region (ARP35090_T100)
• Protein Size (# AA): 394 amino acids
• Molecular Weight: 43kDa
• NCBI Gene Id: 3777
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Potassium channel, subfamily K, member 3
• Alias Symbols: OAT1, PPH4, TASK, TASK1, TBAK1, K2p3.1, TASK-1
• Peptide Sequence: Synthetic peptide located within the following region: TCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Rusznak,Z., et al., (2004) Cell. Mol. Life Sci. 61 (12), 1532-1542
• Description of Target: KCNK3 encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The gene product is an outwardly rectifying channel that is sensitive to changes in extracellular pH and is inhibited by extracellular acidification. Also referred to as an acid-sensitive potassium channel, it is activated by the anesthetics halothane and isoflurane. Although three transcripts are detected in northern blots, there is currently no sequence available to confirm transcript variants for this gene.
• Protein Interactions: YWHAB; COPB1; YWHAG; YWHAE; SFN; YWHAZ; YWHAQ; S100A10; YWHAH;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-KCNK3 (ARP35090_T100) antibody is Catalog # AAP35090 (Previous Catalog # AAPP08952)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human KCNK3
• Uniprot ID: O14649
• Protein Name: Potassium channel subfamily K member 3
• Publications:

  Donner, B. C. et al. Functional role of TASK-1 in the heart: studies in TASK-1-deficient mice show prolonged cardiac repolarization and reduced heart rate variability. Basic Res. Cardiol. 106, 75-87 (2011). 20978771

  Nogueira, E. F., Gerry, D., Mantero, F., Mariniello, B. & Rainey, W. E. The role of TASK1 in aldosterone production and its expression in normal adrenal and aldosterone-producing adenomas. Clin. Endocrinol. (Oxf). 73, 22-9 (2010). 19878209

• Protein Accession #: NP_002237
• Purification: Protein A purified
• Nucleotide Accession #: NM_002246
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: KCNK3
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Sheep
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Sheep: 100%
• Image 1: Hela, Liver tumor
  
  Host: Rabbit
  Target: KCNK3
  Positive control (+): Hela (HL)
  Negative control (-): Liver tumor (T-LI)
  Antibody concentration: 3ug/ml
• Image 2: Human Jurkat
  
  WB Suggested Anti-KCNK3 Antibody Titration: 1.25ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Jurkat cell lysate
• Image 3: Mouse Kidney
  
  Host: Mouse
  Target Name: KCNK3
  Sample Tissue: Mouse Kidney
  Antibody Dilution: 1ug/ml