CLIC2 Antibody - middle region (ARP35047_T100)

Data Sheet
 
Product Number ARP35047_T100
Product Page www.avivasysbio.com/clic2-antibody-middle-region-arp35047-t100.html
Name CLIC2 Antibody - middle region (ARP35047_T100)
Protein Size (# AA) 247 amino acids
Molecular Weight 27kDa
NCBI Gene Id 1193
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Chloride intracellular channel 2
Alias Symbols CLCNL2, CLIC2b, MRXS32, XAP121
Peptide Sequence Synthetic peptide located within the following region: HLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Fan,L., et al., (2003) FEBS Lett. 540 (1-3), 77-80
Description of Target Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 2 (CLIon Channel2) is a member of the p64 family; the protein is detected in fetal liver and adult skeletal muscle tissue.
Protein Interactions UBC; FN1; NEDD4L; NEDD4; TRAPPC2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CLIC2 (ARP35047_T100) antibody
Blocking Peptide For anti-CLIC2 (ARP35047_T100) antibody is Catalog # AAP35047 (Previous Catalog # AAPP06274)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CLIC2
Uniprot ID O15247
Protein Name Chloride intracellular channel protein 2
Protein Accession # NP_001280
Purification Protein A purified
Nucleotide Accession # NM_001289
Tested Species Reactivity Human
Gene Symbol CLIC2
Predicted Species Reactivity Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Rabbit: 93%; Rat: 93%
Image 1
Human Jurkat
WB Suggested Anti-CLIC2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com