CLIC2 Antibody - C-terminal region (ARP35046_T100)

Data Sheet
 
Product Number ARP35046_T100
Product Page www.avivasysbio.com/clic2-antibody-c-terminal-region-arp35046-t100.html
Name CLIC2 Antibody - C-terminal region (ARP35046_T100)
Protein Size (# AA) 247 amino acids
Molecular Weight 27kDa
NCBI Gene Id 1193
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Chloride intracellular channel 2
Alias Symbols CLCNL2, CLIC2b, MRXS32, XAP121
Peptide Sequence Synthetic peptide located within the following region: SAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Fan,L., et al., (2003) FEBS Lett. 540 (1-3), 77-80
Description of Target Chloride intracellular channel 2 is a member of the p64 family, a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. CLIon Channel 2 encodes a protein that is detected in fetal liver and adult skeletal muscle tissue. CLIon Channel2 maps to the candidate region on chromosome X for incontinentia pigmenti.
Protein Interactions UBC; FN1; NEDD4L; NEDD4; TRAPPC2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CLIC2 (ARP35046_T100) antibody
Blocking Peptide For anti-CLIC2 (ARP35046_T100) antibody is Catalog # AAP35046 (Previous Catalog # AAPP06273)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CLIC2
Uniprot ID O15247
Protein Name Chloride intracellular channel protein 2
Protein Accession # NP_001280
Purification Protein A purified
Nucleotide Accession # NM_001289
Tested Species Reactivity Human
Gene Symbol CLIC2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-CLIC2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com