Product Number |
ARP35046_T100 |
Product Page |
www.avivasysbio.com/clic2-antibody-c-terminal-region-arp35046-t100.html |
Name |
CLIC2 Antibody - C-terminal region (ARP35046_T100) |
Protein Size (# AA) |
247 amino acids |
Molecular Weight |
27kDa |
NCBI Gene Id |
1193 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Chloride intracellular channel 2 |
Alias Symbols |
CLCNL2, CLIC2b, MRXS32, XAP121 |
Peptide Sequence |
Synthetic peptide located within the following region: SAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRDFDIPAEFSG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Fan,L., et al., (2003) FEBS Lett. 540 (1-3), 77-80 |
Description of Target |
Chloride intracellular channel 2 is a member of the p64 family, a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. CLIon Channel 2 encodes a protein that is detected in fetal liver and adult skeletal muscle tissue. CLIon Channel2 maps to the candidate region on chromosome X for incontinentia pigmenti. |
Protein Interactions |
UBC; FN1; NEDD4L; NEDD4; TRAPPC2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CLIC2 (ARP35046_T100) antibody |
Blocking Peptide |
For anti-CLIC2 (ARP35046_T100) antibody is Catalog # AAP35046 (Previous Catalog # AAPP06273) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CLIC2 |
Uniprot ID |
O15247 |
Protein Name |
Chloride intracellular channel protein 2 |
Protein Accession # |
NP_001280 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_001289 |
Tested Species Reactivity |
Human |
Gene Symbol |
CLIC2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-CLIC2 Antibody Titration: 1.25ug/ml ELISA Titer: 1:312500 Positive Control: HepG2 cell lysate |
|