| Product Number |
ARP35033_P050 |
| Product Page |
www.avivasysbio.com/accn1-antibody-c-terminal-region-arp35033-p050.html |
| Name |
ACCN1 Antibody - C-terminal region (ARP35033_P050) |
| Protein Size (# AA) |
563 amino acids |
| Molecular Weight |
63kDa |
| NCBI Gene Id |
40 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Acid-sensing (proton-gated) ion channel 2 |
| Alias Symbols |
ACCN, BNC1, MDEG, ACCN1, BNaC1, ASIC2a, hBNaC1 |
| Peptide Sequence |
Synthetic peptide located within the following region: GDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Saugstad,J.A., et al., (2004) J. Biol. Chem. 279 (53), 55514-55519 |
| Description of Target |
ACCN1 is a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. ACCN1 may play a role in neurotransmission. In addition, a heteromeric association between ACCN1 and ACCN3 (variant 1) has been observed to co-assemble into proton-gated channels sensitive to gadolinium. |
| Protein Interactions |
PICK1; ASIC3; ASIC1; STOM; STOML1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ASIC2 (ARP35033_P050) antibody |
| Blocking Peptide |
For anti-ASIC2 (ARP35033_P050) antibody is Catalog # AAP35033 (Previous Catalog # AAPP06260) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ACCN1 |
| Uniprot ID |
Q16515-2 |
| Protein Name |
Acid-sensing ion channel 2 |
| Protein Accession # |
NP_899233 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_183377 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ASIC2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-ACCN1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate |
|
