GABRA1 Antibody - N-terminal region (ARP34976_P050)

Data Sheet
 
Product Number ARP34976_P050
Product Page www.avivasysbio.com/gabra1-antibody-n-terminal-region-arp34976-p050.html
Name GABRA1 Antibody - N-terminal region (ARP34976_P050)
Protein Size (# AA) 456 amino acids
Molecular Weight 52kDa
Subunit alpha-1
NCBI Gene Id 2554
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Gamma-aminobutyric acid (GABA) A receptor, alpha 1
Alias Symbols EJM, ECA4, EJM5, DEE19, EIEE19
Peptide Sequence Synthetic peptide located within the following region: WAWILLLSTLTGRSYGQPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Peran,M., et al., (2004) Neurosci. Lett. 364 (2), 67-70
Description of Target GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified.
Protein Interactions UBQLN1; PRKCG; PRKCD; PPP3CA;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GABRA1 (ARP34976_P050) antibody
Blocking Peptide For anti-GABRA1 (ARP34976_P050) antibody is Catalog # AAP34976 (Previous Catalog # AAPP06203)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GABRA1
Uniprot ID P14867
Protein Name Gamma-aminobutyric acid receptor subunit alpha-1
Protein Accession # NP_000797
Purification Affinity Purified
Nucleotide Accession # NM_000806
Tested Species Reactivity Human
Gene Symbol GABRA1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Pig, Rabbit
Application WB, IP
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Human: 100%; Mouse: 92%; Pig: 86%; Rabbit: 100%; Rat: 92%
Image 1
Human HepG2
WB Suggested Anti-GABRA1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Image 2
HEK293 Whole Cell Lysate
GABRA1 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with ARP34976_P050 with 1:200 dilution. Western blot was performed using ARP34976_P050 at 1/1000 dilution.
Lane 1: Control IP in HEK293 Whole Cell Lysate.
Lane 2: GABRA1 IP with ARP34976_P050 in HEK293 Whole Cell Lysate.
Lane 3: Input of HEK293 Whole Cell Lysate.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com