Product Number |
ARP34976_P050 |
Product Page |
www.avivasysbio.com/gabra1-antibody-n-terminal-region-arp34976-p050.html |
Name |
GABRA1 Antibody - N-terminal region (ARP34976_P050) |
Protein Size (# AA) |
456 amino acids |
Molecular Weight |
52kDa |
Subunit |
alpha-1 |
NCBI Gene Id |
2554 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Gamma-aminobutyric acid (GABA) A receptor, alpha 1 |
Alias Symbols |
EJM, ECA4, EJM5, DEE19, EIEE19 |
Peptide Sequence |
Synthetic peptide located within the following region: WAWILLLSTLTGRSYGQPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Peran,M., et al., (2004) Neurosci. Lett. 364 (2), 67-70 |
Description of Target |
GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified. |
Protein Interactions |
UBQLN1; PRKCG; PRKCD; PPP3CA; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-GABRA1 (ARP34976_P050) antibody |
Blocking Peptide |
For anti-GABRA1 (ARP34976_P050) antibody is Catalog # AAP34976 (Previous Catalog # AAPP06203) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GABRA1 |
Uniprot ID |
P14867 |
Protein Name |
Gamma-aminobutyric acid receptor subunit alpha-1 |
Protein Accession # |
NP_000797 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_000806 |
Tested Species Reactivity |
Human |
Gene Symbol |
GABRA1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Pig, Rabbit |
Application |
WB, IP |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Human: 100%; Mouse: 92%; Pig: 86%; Rabbit: 100%; Rat: 92% |
Image 1 | Human HepG2
| WB Suggested Anti-GABRA1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysate |
|
Image 2 | HEK293 Whole Cell Lysate
| GABRA1 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with ARP34976_P050 with 1:200 dilution. Western blot was performed using ARP34976_P050 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: GABRA1 IP with ARP34976_P050 in HEK293 Whole Cell Lysate. Lane 3: Input of HEK293 Whole Cell Lysate. |
|