CHRNA5 Antibody - middle region (ARP34967_T100)

Data Sheet
 
Product Number ARP34967_T100
Product Page www.avivasysbio.com/chrna5-antibody-middle-region-arp34967-t100.html
Name CHRNA5 Antibody - middle region (ARP34967_T100)
Protein Size (# AA) 468 amino acids
Molecular Weight 53kDa
Subunit alpha-5
NCBI Gene Id 1138
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Cholinergic receptor, nicotinic, alpha 5 (neuronal)
Alias Symbols LNCR2
Peptide Sequence Synthetic peptide located within the following region: DGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Groot-Kormelink,P.J., et al., (2001) Br. J. Pharmacol. 134 (4), 789-796
Description of Target Nicotinic acetylcholine receptors (nAChRs), such as CHRNA5, are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be (hetero)pentamers composed of homologous subunits.
Protein Interactions UBC; CANX; CHRNB4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CHRNA5 (ARP34967_T100) antibody
Blocking Peptide For anti-CHRNA5 (ARP34967_T100) antibody is Catalog # AAP34967 (Previous Catalog # AAPP06190)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CHRNA5
Uniprot ID P30532
Protein Name Neuronal acetylcholine receptor subunit alpha-5
Protein Accession # NP_000736
Purification Protein A purified
Nucleotide Accession # NM_000745
Tested Species Reactivity Human
Gene Symbol CHRNA5
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
Image 1
Human Jurkat
WB Suggested Anti-CHRNA5 Antibody Titration: 1.0ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com