Product Number |
ARP34967_T100 |
Product Page |
www.avivasysbio.com/chrna5-antibody-middle-region-arp34967-t100.html |
Name |
CHRNA5 Antibody - middle region (ARP34967_T100) |
Protein Size (# AA) |
468 amino acids |
Molecular Weight |
53kDa |
Subunit |
alpha-5 |
NCBI Gene Id |
1138 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Cholinergic receptor, nicotinic, alpha 5 (neuronal) |
Alias Symbols |
LNCR2 |
Peptide Sequence |
Synthetic peptide located within the following region: DGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Groot-Kormelink,P.J., et al., (2001) Br. J. Pharmacol. 134 (4), 789-796 |
Description of Target |
Nicotinic acetylcholine receptors (nAChRs), such as CHRNA5, are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be (hetero)pentamers composed of homologous subunits. |
Protein Interactions |
UBC; CANX; CHRNB4; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CHRNA5 (ARP34967_T100) antibody |
Blocking Peptide |
For anti-CHRNA5 (ARP34967_T100) antibody is Catalog # AAP34967 (Previous Catalog # AAPP06190) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CHRNA5 |
Uniprot ID |
P30532 |
Protein Name |
Neuronal acetylcholine receptor subunit alpha-5 |
Protein Accession # |
NP_000736 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_000745 |
Tested Species Reactivity |
Human |
Gene Symbol |
CHRNA5 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79% |
Image 1 | Human Jurkat
| WB Suggested Anti-CHRNA5 Antibody Titration: 1.0ug/ml ELISA Titer: 1:12500 Positive Control: Jurkat cell lysate |
|
|