CACNB4 Antibody - C-terminal region (ARP34959_P050)

• Product Number: ARP34959_P050
• Name: CACNB4 Antibody - C-terminal region (ARP34959_P050)
• Protein Size (# AA): 486 amino acids
• Molecular Weight: 55kDa
• Subunit: beta-4
• NCBI Gene Id: 785
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Calcium channel, voltage-dependent, beta 4 subunit
• Alias Symbols: EA5, EJM, CAB4, EIG9, EJM4, EJM6, CACNLB4
• Peptide Sequence: Synthetic peptide located within the following region: LEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Suzuki,Y., et al., (2004) Genome Res. 14 (9), 1711-1718
• Description of Target: CACNB4 is a member of the beta subunit family, a protein in the voltage-dependent calcium channel complex. CACNB4 plays an important role in calcium channel function by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. This gene encodes a member of the beta subunit family, a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Various versions of each of these subunits exist, either expressed from similar genes or the result of alternative splicing. The protein described in this record plays an important role in calcium channel function by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Certain mutations in this gene have been associated with idiopathic generalized epilepsy (IGE) and juvenile myoclonic epilepsy (JME). Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized.
• Protein Interactions: CBX3; FASLG; REM1; MED31; TBL3; CACNA1A; PTN;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CACNB4 (ARP34959_P050) antibody is Catalog # AAP34959 (Previous Catalog # AAPP06182)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CACNB4
• Uniprot ID: O00305-2
• Protein Name: Voltage-dependent L-type calcium channel subunit beta-4
• Protein Accession #: NP_001005747
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001005747
• Tested Species Reactivity: Human
• Gene Symbol: CACNB4
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-CACNB4 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:12500
  Positive Control: Jurkat cell lysate