Product Number |
ARP34958_P050 |
Product Page |
www.avivasysbio.com/cacnb3-antibody-n-terminal-region-arp34958-p050.html |
Name |
CACNB3 Antibody - N-terminal region (ARP34958_P050) |
Protein Size (# AA) |
447 amino acids |
Molecular Weight |
49kDa |
Subunit |
beta-3 |
NCBI Gene Id |
784 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Calcium channel, voltage-dependent, beta 3 subunit |
Alias Symbols |
CAB3, CACNLB3 |
Peptide Sequence |
Synthetic peptide located within the following region: MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQ |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting. |
Protein Interactions |
FASLG; CACNA1C; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CACNB3 (ARP34958_P050) antibody |
Blocking Peptide |
For anti-CACNB3 (ARP34958_P050) antibody is Catalog # AAP34958 (Previous Catalog # AAPP06181) |
Immunogen |
The immunogen is a synthetic peptide directed towards the n terminal region of human CACNB3 |
Uniprot ID |
P54284 |
Protein Name |
Voltage-dependent L-type calcium channel subunit beta-3 |
Sample Type Confirmation |
CACNB3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
CAA54056 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_000725 |
Tested Species Reactivity |
Human |
Gene Symbol |
CACNB3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 92%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-CACNB3 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Jurkat cell lysateCACNB3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells |
|
|