Product Number |
ARP34957_T100 |
Product Page |
www.avivasysbio.com/cacnb3-antibody-c-terminal-region-arp34957-t100.html |
Name |
CACNB3 Antibody - C-terminal region (ARP34957_T100) |
Protein Size (# AA) |
484 amino acids |
Molecular Weight |
53kDa |
Subunit |
beta-3 |
NCBI Gene Id |
784 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Calcium channel, voltage-dependent, beta 3 subunit |
Alias Symbols |
CAB3, CACNLB3 |
Peptide Sequence |
Synthetic peptide located within the following region: EHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPH |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Murakami,M., et al., (1996) Eur. J. Biochem. 236 (1), 138-143 |
Description of Target |
The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting. |
Protein Interactions |
FASLG; CACNA1C; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CACNB3 (ARP34957_T100) antibody |
Blocking Peptide |
For anti-CACNB3 (ARP34957_T100) antibody is Catalog # AAP34957 (Previous Catalog # AAPP06180) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CACNB3 |
Uniprot ID |
P54284 |
Protein Name |
Voltage-dependent L-type calcium channel subunit beta-3 |
Sample Type Confirmation |
CACNB3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_000716 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_000725 |
Tested Species Reactivity |
Human |
Gene Symbol |
CACNB3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-CACNB3 Antibody Titration: 2.5ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysateCACNB3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells |
|