| Product Number |
ARP34955_T100 |
| Product Page |
www.avivasysbio.com/cacnb2-antibody-middle-region-arp34955-t100.html |
| Name |
CACNB2 Antibody - middle region (ARP34955_T100) |
| Protein Size (# AA) |
605 amino acids |
| Molecular Weight |
67kDa |
| Subunit |
beta-2 |
| NCBI Gene Id |
783 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Calcium channel, voltage-dependent, beta 2 subunit |
| Alias Symbols |
CAB2, MYSB, CAVB2, CACNLB2 |
| Peptide Sequence |
Synthetic peptide located within the following region: DYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGSQGDQRT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Foell,J.D., et al., (2004) Physiol. Genomics 17 (2), 183-200 |
| Description of Target |
CACNB2 is a member of the ion-channel gene superfamily. Described as a Lambert-Eaton myasthenic syndrome (LEMS) antigen in humans, this gene is found close to a region that undergoes chromosome rearrangements in small cell lung cancer, which occurs in association with LEMS. |
| Protein Interactions |
REM1; PRKACA; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CACNB2 (ARP34955_T100) antibody |
| Blocking Peptide |
For anti-CACNB2 (ARP34955_T100) antibody is Catalog # AAP34955 (Previous Catalog # AAPP06178) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CACNB2 |
| Uniprot ID |
Q5VWD7 |
| Sample Type Confirmation |
CACNB2 is strongly supported by BioGPS gene expression data to be expressed in Raji |
| Protein Accession # |
NP_000715 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_000724 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CACNB2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93% |
| Image 1 | Human Raji
 | WB Suggested Anti-CACNB2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:12500
Positive Control: Raji cell lysateCACNB2 is strongly supported by BioGPS gene expression data to be expressed in Human Raji cells |
|
