CACNB1 Antibody - N-terminal region (ARP34953_P050)

Data Sheet
 
Product Number ARP34953_P050
Product Page www.avivasysbio.com/cacnb1-antibody-n-terminal-region-arp34953-p050.html
Name CACNB1 Antibody - N-terminal region (ARP34953_P050)
Protein Size (# AA) 598 amino acids
Molecular Weight 66kDa
Subunit beta-1
NCBI Gene Id 782
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Calcium channel, voltage-dependent, beta 1 subunit
Alias Symbols CAB1, CCHLB1, CACNLB1
Peptide Sequence Synthetic peptide located within the following region: EVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSAESYTSRPSDS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Hogan,K., et al., (1999) Neurosci. Lett. 277 (2), 111-114
Description of Target The protein encoded by CACNB1 belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation.
Protein Interactions SRPK1; APP; ATN1; NEDD4L; UBC; REM1; DYNLL1; CACNA1A;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CACNB1 (ARP34953_P050) antibody
Blocking Peptide For anti-CACNB1 (ARP34953_P050) antibody is Catalog # AAP34953 (Previous Catalog # AAPP06176)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CACNB1
Uniprot ID Q02641
Protein Name Voltage-dependent L-type calcium channel subunit beta-1
Protein Accession # NP_000714
Purification Affinity Purified
Nucleotide Accession # NM_000723
Tested Species Reactivity Human
Gene Symbol CACNB1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human HepG2
WB Suggested Anti-CACNB1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Image 2
Human Adult Placenta
Host: Rabbit
Target Name: CACNB1
Sample Type: Human Adult Placenta
Antibody Dilution: 1.0ug/ml
Image 3
Human Fetal Muscle
Host: Rabbit
Target Name: CACNB1
Sample Type: Human Fetal Muscle
Antibody Dilution: 1.0ug/ml
Image 4
Human Fetal Liver
Host: Rabbit
Target Name: CACNB1
Sample Type: Human Fetal Liver
Antibody Dilution: 1.0ug/ml
Image 5
Human Fetal Lung
Host: Rabbit
Target Name: CACNB1
Sample Type: Human Fetal Lung
Antibody Dilution: 1.0ug/ml
Image 6
Human Fetal Heart
Host: Rabbit
Target Name: CACNB1
Sample Type: Human Fetal Heart
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com