Product Number |
ARP34953_P050 |
Product Page |
www.avivasysbio.com/cacnb1-antibody-n-terminal-region-arp34953-p050.html |
Name |
CACNB1 Antibody - N-terminal region (ARP34953_P050) |
Protein Size (# AA) |
598 amino acids |
Molecular Weight |
66kDa |
Subunit |
beta-1 |
NCBI Gene Id |
782 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Calcium channel, voltage-dependent, beta 1 subunit |
Alias Symbols |
CAB1, CCHLB1, CACNLB1 |
Peptide Sequence |
Synthetic peptide located within the following region: EVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSAESYTSRPSDS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Hogan,K., et al., (1999) Neurosci. Lett. 277 (2), 111-114 |
Description of Target |
The protein encoded by CACNB1 belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. |
Protein Interactions |
SRPK1; APP; ATN1; NEDD4L; UBC; REM1; DYNLL1; CACNA1A; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CACNB1 (ARP34953_P050) antibody |
Blocking Peptide |
For anti-CACNB1 (ARP34953_P050) antibody is Catalog # AAP34953 (Previous Catalog # AAPP06176) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CACNB1 |
Uniprot ID |
Q02641 |
Protein Name |
Voltage-dependent L-type calcium channel subunit beta-1 |
Protein Accession # |
NP_000714 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_000723 |
Tested Species Reactivity |
Human |
Gene Symbol |
CACNB1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-CACNB1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysate |
|
Image 2 | Human Adult Placenta
| Host: Rabbit Target Name: CACNB1 Sample Type: Human Adult Placenta Antibody Dilution: 1.0ug/ml |
|
Image 3 | Human Fetal Muscle
| Host: Rabbit Target Name: CACNB1 Sample Type: Human Fetal Muscle Antibody Dilution: 1.0ug/ml |
|
Image 4 | Human Fetal Liver
| Host: Rabbit Target Name: CACNB1 Sample Type: Human Fetal Liver Antibody Dilution: 1.0ug/ml |
|
Image 5 | Human Fetal Lung
| Host: Rabbit Target Name: CACNB1 Sample Type: Human Fetal Lung Antibody Dilution: 1.0ug/ml |
|
Image 6 | Human Fetal Heart
| Host: Rabbit Target Name: CACNB1 Sample Type: Human Fetal Heart Antibody Dilution: 1.0ug/ml |
|