Product Number |
ARP34952_P050 |
Product Page |
www.avivasysbio.com/cacna2d1-antibody-middle-region-arp34952-p050.html |
Name |
CACNA2D1 Antibody - middle region (ARP34952_P050) |
Protein Size (# AA) |
1091 amino acids |
Molecular Weight |
120kDa |
Subunit |
alpha-2/delta-1 |
NCBI Gene Id |
781 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Calcium channel, voltage-dependent, alpha 2/delta subunit 1 |
Alias Symbols |
CACNA2, CCHL2A, CACNL2A, LINC01112, lncRNA-N3 |
Peptide Sequence |
Synthetic peptide located within the following region: PKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYI |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Stotz,S.C., et al., (2004) J. Biol. Chem. 279 (5), 3793-3800 |
Description of Target |
CACNA2D1 encodes a member of the alpha-2/delta subunit family, a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. |
Protein Interactions |
STT3B; RAB11A; NDUFS4; Cep76; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CACNA2D1 (ARP34952_P050) antibody |
Blocking Peptide |
For anti-CACNA2D1 (ARP34952_P050) antibody is Catalog # AAP34952 (Previous Catalog # AAPP06175) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CACNA2D1 |
Uniprot ID |
P54289 |
Protein Name |
Voltage-dependent calcium channel subunit alpha-2/delta-1 |
Publications |
Identification of Glycosylation Sites Essential for Surface Expression of the CaVa2d1 Subunit and Modulation of the Cardiac CaV1.2 Channel Activity. J. Biol. Chem. 291, 4826-43 (2016). 26742847 |
Protein Accession # |
NP_000713 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_000722 |
Tested Species Reactivity |
Human |
Gene Symbol |
CACNA2D1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Fetal Muscle
| Host: Rabbit Target Name: CACNA2D1 Sample Type: Fetal Muscle Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide Primary Antibody Concentration: 1ug/ml Peptide Concentration: 5ug/ml Lysate Quantity: 25ug/lane/Lane Gel Concentration: 0.12 |
|
Image 2 | Human Liver, MCF7 Cell Lysate
| Host: Rabbit Target: CACNA2D1 Positive control (+): Human Liver (LI) Negative control (-): MCF7 Cell Lysate (N10) Antibody concentration: 3ug/ml |
|
Image 3 | Human Muscle
| WB Suggested Anti-CACNA2D1 Antibody Titration: 0.12ug/ml ELISA Titer: 1:312500 Positive Control: Human Muscle |
|
Image 4 | Human A549 Whole Cell
| Host: Rabbit Target Name: CACNA2D1 Sample Tissue: Human A549 Whole Cell Antibody Dilution: 3ug/ml |
|