CACNA2D1 Antibody - middle region (ARP34952_P050)

Data Sheet
 
Product Number ARP34952_P050
Product Page www.avivasysbio.com/cacna2d1-antibody-middle-region-arp34952-p050.html
Name CACNA2D1 Antibody - middle region (ARP34952_P050)
Protein Size (# AA) 1091 amino acids
Molecular Weight 120kDa
Subunit alpha-2/delta-1
NCBI Gene Id 781
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Calcium channel, voltage-dependent, alpha 2/delta subunit 1
Alias Symbols CACNA2, CCHL2A, CACNL2A, LINC01112, lncRNA-N3
Peptide Sequence Synthetic peptide located within the following region: PKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Stotz,S.C., et al., (2004) J. Biol. Chem. 279 (5), 3793-3800
Description of Target CACNA2D1 encodes a member of the alpha-2/delta subunit family, a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio.
Protein Interactions STT3B; RAB11A; NDUFS4; Cep76;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CACNA2D1 (ARP34952_P050) antibody
Blocking Peptide For anti-CACNA2D1 (ARP34952_P050) antibody is Catalog # AAP34952 (Previous Catalog # AAPP06175)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CACNA2D1
Uniprot ID P54289
Protein Name Voltage-dependent calcium channel subunit alpha-2/delta-1
Publications

Identification of Glycosylation Sites Essential for Surface Expression of the CaVa2d1 Subunit and Modulation of the Cardiac CaV1.2 Channel Activity. J. Biol. Chem. 291, 4826-43 (2016). 26742847

Protein Accession # NP_000713
Purification Affinity Purified
Nucleotide Accession # NM_000722
Tested Species Reactivity Human
Gene Symbol CACNA2D1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Fetal Muscle
Host: Rabbit
Target Name: CACNA2D1
Sample Type: Fetal Muscle
Lane A: Primary Antibody
Lane B: Primary Antibody + Blocking Peptide
Primary Antibody Concentration: 1ug/ml
Peptide Concentration: 5ug/ml
Lysate Quantity: 25ug/lane/Lane
Gel Concentration: 0.12
Image 2
Human Liver, MCF7 Cell Lysate
Host: Rabbit
Target: CACNA2D1
Positive control (+): Human Liver (LI)
Negative control (-): MCF7 Cell Lysate (N10)
Antibody concentration: 3ug/ml
Image 3
Human Muscle
WB Suggested Anti-CACNA2D1 Antibody Titration: 0.12ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle
Image 4
Human A549 Whole Cell
Host: Rabbit
Target Name: CACNA2D1
Sample Tissue: Human A549 Whole Cell
Antibody Dilution: 3ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com