| Product Number |
ARP34916_P050 |
| Product Page |
www.avivasysbio.com/clcnkb-antibody-n-terminal-region-arp34916-p050.html |
| Name |
CLCNKB Antibody - N-terminal region (ARP34916_P050) |
| Protein Size (# AA) |
462 amino acids |
| Molecular Weight |
50kDa |
| NCBI Gene Id |
1188 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Chloride channel, voltage-sensitive Kb |
| Alias Symbols |
CLCKB, ClC-K2, ClC-Kb |
| Peptide Sequence |
Synthetic peptide located within the following region: MEEFVGLREGSSGNPVTLQELWGPCPRIRRGIRGGLEWLKQKLFRLGEDW |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Strausberg,R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
| Description of Target |
Chloride channel Kb (CLCNKB) is a member of the CLC family of voltage-gated chloride channels, which comprises at least 9 mammalian chloride channels. Each is believed to have 12 transmembrane domains and intracellular N and C termini. Mutations in CLCNKB result in the autosomal recessive Type III Bartter Syndrome. CLCNKA and CLCNKB are closely related (94% sequence identity), tightly linked (separated by 11 kb of genomic sequence) and are both expressed in mammalian kidney. |
| Protein Interactions |
Dlg4; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CLCNKB (ARP34916_P050) antibody |
| Blocking Peptide |
For anti-CLCNKB (ARP34916_P050) antibody is Catalog # AAP34916 (Previous Catalog # AAPP06140) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CLCNKB |
| Uniprot ID |
Q8WW53 |
| Protein Name |
CLCNKB protein EMBL AAH20873.1 |
| Protein Accession # |
AAH20873 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000085 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CLCNKB |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-CLCNKB Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate |
|
|
