| Product Number |
ARP34910_P050 |
| Product Page |
www.avivasysbio.com/chrna1-antibody-n-terminal-region-arp34910-p050.html |
| Name |
CHRNA1 Antibody - N-terminal region (ARP34910_P050) |
| Protein Size (# AA) |
457 amino acids |
| Molecular Weight |
52kDa |
| Subunit |
alpha |
| NCBI Gene Id |
1134 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Cholinergic receptor, nicotinic, alpha 1 (muscle) |
| Alias Symbols |
ACHRA, ACHRD, CHRNA, CMS1A, CMS1B, CMS2A, FCCMS, SCCMS |
| Peptide Sequence |
Synthetic peptide located within the following region: AGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Webster,R., et al., (2004) Neurology 62 (7), 1090-1096 |
| Description of Target |
The muscle acetylcholine receptor consiststs of 5 subunits of 4 different types: 2 alpha isoforms and 1 each of beta, gamma, and delta subunits.2 The CHRNA1 gene encodes an alpha subunit that plays a role in acetlycholine binding/channel gating. |
| Protein Interactions |
ITGA7; CHRND; CHRNG; CHRNE; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CHRNA1 (ARP34910_P050) antibody |
| Blocking Peptide |
For anti-CHRNA1 (ARP34910_P050) antibody is Catalog # AAP34910 (Previous Catalog # AAPP06134) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNA1 |
| Uniprot ID |
Q53SH4 |
| Protein Name |
Cholinergic receptor, nicotinic, alpha 1 (Muscle), isoform CRA_a EMBL EAX11124.1 |
| Protein Accession # |
NP_000070 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000079 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CHRNA1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human kidney
 | WB Suggested Anti-CHRNA1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:2500
Positive Control: Human kidney |
|
