| Product Number |
ARP34900_T100 |
| Product Page |
www.avivasysbio.com/znf547-antibody-n-terminal-region-arp34900-t100.html |
| Name |
ZNF547 Antibody - N-terminal region (ARP34900_T100) |
| Protein Size (# AA) |
347 amino acids |
| Molecular Weight |
38kDa |
| NCBI Gene Id |
284306 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 547 |
| Alias Symbols |
MIP-2A, SEDLP1, TRAPPC2B, TRAPPC2P1, TRAPPC2.19 |
| Peptide Sequence |
Synthetic peptide located within the following region: GTHPEQGLYTCPAHLHQHQKEQIREKLSRGDGGRPTFVKNHRVHMAGKTF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
ZNF547 may be involved in transcriptional regulation. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF547 (ARP34900_T100) antibody |
| Blocking Peptide |
For anti-ZNF547 (ARP34900_T100) antibody is Catalog # AAP34900 (Previous Catalog # AAPP23681) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF547 |
| Uniprot ID |
Q8IVP9 |
| Protein Name |
Zinc finger protein 547 |
| Protein Accession # |
EAW72498 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_173631 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF547 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZNF547 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate |
|
|
