ZNF57 Antibody - N-terminal region (ARP34891_P050)

• Product Number: ARP34891_P050
• Name: ZNF57 Antibody - N-terminal region (ARP34891_P050)
• Protein Size (# AA): 555 amino acids
• Molecular Weight: 64kDa
• NCBI Gene Id: 126295
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Zinc finger protein 57
• Alias Symbols: ZNF424
• Peptide Sequence: Synthetic peptide located within the following region: FTLEEWALLDSAQRDLYRDVMLETFRNLASVDDGTQFKANGSVSLQDMYG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Strausberg,R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
• Description of Target: ZNF57 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 13 C2H2-type zinc fingers and 1 KRAB domain. ZNF57 may be involved in transcriptional regulation.
• Protein Interactions: SUV39H2; UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZNF57 (ARP34891_P050) antibody is Catalog # AAP34891 (Previous Catalog # AAPS32610)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF57
• Uniprot ID: Q68EA5
• Protein Name: Zinc finger protein 57
• Protein Accession #: NP_775751
• Purification: Affinity Purified
• Nucleotide Accession #: NM_173480
• Tested Species Reactivity: Human
• Gene Symbol: ZNF57
• Predicted Species Reactivity: Human, Cow, Dog, Horse, Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Dog: 85%; Horse: 92%; Human: 100%; Pig: 85%
• Image 1: Human HepG2
  
  WB Suggested Anti-ZNF57 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:12500
  Positive Control: HepG2 cell lysate