DIDO1 Antibody - N-terminal region (ARP34884_P050)

Data Sheet
 
Product Number ARP34884_P050
Product Page www.avivasysbio.com/dido1-antibody-n-terminal-region-arp34884-p050.html
Name DIDO1 Antibody - N-terminal region (ARP34884_P050)
Protein Size (# AA) 544 amino acids
Molecular Weight 59kDa
NCBI Gene Id 11083
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Death inducer-obliterator 1
Alias Symbols BYE1, DIO1, DATF1, DIDO2, DIDO3, DIO-1, DATF-1, C20orf158, dJ885L7.8
Peptide Sequence Synthetic peptide located within the following region: ERVEQFLTIARRRGRRSMPVSLEDSGEPTSCPATDAETASEGSVESASET
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Futterer,A., et al., (2005) J. Clin. Invest. 115 (9), 2351-2362
Description of Target In mice, the death inducer-obliterator-1 gene is upregulated by apoptotic signals and encodes a cytoplasmic protein that translocates to the nucleus upon apoptotic signal activation. When overexpressed, the mouse protein induced apoptosis in cell lines growing in vitro. DIDO1 gene is similar to the mouse gene and therefore is thought to be involved in apoptosis.Apoptosis, a major form of cell death, is an efficient mechanism for eliminating unwanted cells and is of central importance for development and homeostasis in metazoan animals. In mice, the death inducer-obliterator-1 gene is upregulated by apoptotic signals and encodes a cytoplasmic protein that translocates to the nucleus upon apoptotic signal activation. When overexpressed, the mouse protein induced apoptosis in cell lines growing in vitro. This gene is similar to the mouse gene and therefore is thought to be involved in apoptosis. Alternatively spliced transcripts have been found for this gene, encoding multiple isoforms.
Protein Interactions UBC; WWOX; RPA3; RPA2; RPA1; EED; BMI1; HECW2; SRPK2; KCNK4; ARAF; Dlg4; H2AFY; U2AF1; SON; RPL18A; KRT7; APP; PCDHA2; H2AFY2; GNL3; RRS1; SIRT7; SUMO2; WWP2; WWP1; DVL3; SRSF1; HNRNPK;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DIDO1 (ARP34884_P050) antibody
Blocking Peptide For anti-DIDO1 (ARP34884_P050) antibody is Catalog # AAP34884 (Previous Catalog # AAPP06093)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human DIDO1
Uniprot ID Q9BTC0-2
Protein Name Death-inducer obliterator 1
Sample Type Confirmation

DIDO1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_542987
Purification Affinity Purified
Nucleotide Accession # NM_080797
Tested Species Reactivity Human
Gene Symbol DIDO1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 92%; Guinea Pig: 86%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%; Yeast: 79%
Image 1
Human Jurkat
WB Suggested Anti-DIDO1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysateDIDO1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com