| Product Number |
ARP34876_T100 |
| Product Page |
www.avivasysbio.com/znf568-antibody-n-terminal-region-arp34876-t100.html |
| Name |
ZNF568 Antibody - N-terminal region (ARP34876_T100) |
| Protein Size (# AA) |
377 amino acids |
| Molecular Weight |
44kDa |
| NCBI Gene Id |
374900 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 568 |
| Alias Symbols |
ZFP568 |
| Peptide Sequence |
Synthetic peptide located within the following region: VWEVDEQVKKQQETLVRKVTSISKKILIKEKVIECKKVAKIFPLSSDIVT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Koehrer,K., et al., Unpublished (2003) |
| Description of Target |
ZNF568 is a candidate transcription factor |
| Protein Interactions |
SUMO1; ILK; CBX5; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF568 (ARP34876_T100) antibody |
| Blocking Peptide |
For anti-ZNF568 (ARP34876_T100) antibody is Catalog # AAP34876 (Previous Catalog # AAPP06085) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF568 |
| Uniprot ID |
Q6N060 |
| Protein Name |
Zinc finger protein 568 |
| Protein Accession # |
NP_940941 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_198539 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF568 |
| Predicted Species Reactivity |
Human, Cow, Dog, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Pig: 93% |
| Image 1 | Human HepG2
 | WB Suggested Anti-ZNF568 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate |
|
|
