Product Number |
ARP34872_P050 |
Product Page |
www.avivasysbio.com/trim35-antibody-c-terminal-region-arp34872-p050.html |
Name |
TRIM35 Antibody - C-terminal region (ARP34872_P050) |
Protein Size (# AA) |
493 amino acids |
Molecular Weight |
54kDa |
NCBI Gene Id |
23087 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Tripartite motif containing 35 |
Alias Symbols |
HLS5, MAIR |
Peptide Sequence |
Synthetic peptide located within the following region: RVRSLIAEERRNFLPTHQWIVTKTRLQTSSPNLQSRRQGQVQEHGACTAG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Lalonde J.-P., et al., (2004) J. Biol. Chem. 279:8181-8189 |
Description of Target |
TRIM35 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. TRIM35 may play a role as a tumor suppressor, and is implicated in the cell death mechanism |
Protein Interactions |
USP49; PAN2; USP2; TRIM5; TRIM11; UBE2U; UBE2W; UBE2D4; UBE2D3; UBE2D2; UBE2D1; TSG101; UBE2K; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TRIM35 (ARP34872_P050) antibody |
Blocking Peptide |
For anti-TRIM35 (ARP34872_P050) antibody is Catalog # AAP34872 (Previous Catalog # AAPP06081) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human TRIM35 |
Uniprot ID |
Q9UPQ4-2 |
Protein Name |
Tripartite motif-containing protein 35 |
Purification |
Affinity Purified |
Tested Species Reactivity |
Human |
Gene Symbol |
TRIM35 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-TRIM35 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysate |
|
|