TRIM35 Antibody - C-terminal region (ARP34872_P050)

• Product Number: ARP34872_P050
• Name: TRIM35 Antibody - C-terminal region (ARP34872_P050)
• Protein Size (# AA): 493 amino acids
• Molecular Weight: 54kDa
• NCBI Gene Id: 23087
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Tripartite motif containing 35
• Alias Symbols: HLS5, MAIR
• Peptide Sequence: Synthetic peptide located within the following region: RVRSLIAEERRNFLPTHQWIVTKTRLQTSSPNLQSRRQGQVQEHGACTAG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Lalonde J.-P., et al., (2004) J. Biol. Chem. 279:8181-8189
• Description of Target: TRIM35 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. TRIM35 may play a role as a tumor suppressor, and is implicated in the cell death mechanism
• Protein Interactions: USP49; PAN2; USP2; TRIM5; TRIM11; UBE2U; UBE2W; UBE2D4; UBE2D3; UBE2D2; UBE2D1; TSG101; UBE2K;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-TRIM35 (ARP34872_P050) antibody is Catalog # AAP34872 (Previous Catalog # AAPP06081)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TRIM35
• Uniprot ID: Q9UPQ4-2
• Protein Name: Tripartite motif-containing protein 35
• Purification: Affinity Purified
• Tested Species Reactivity: Human
• Gene Symbol: TRIM35
• Predicted Species Reactivity: Human
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-TRIM35 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: HepG2 cell lysate