Product Number |
ARP34860_P050 |
Product Page |
www.avivasysbio.com/trim14-antibody-middle-region-arp34860-p050.html |
Name |
TRIM14 Antibody - middle region (ARP34860_P050) |
Protein Size (# AA) |
253 amino acids |
Molecular Weight |
28kDa |
NCBI Gene Id |
9830 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Tripartite motif containing 14 |
Alias Symbols |
KIAA0129 |
Peptide Sequence |
Synthetic peptide located within the following region: SFEPVKSFFKGLVEAVESTLQTPLDIRLSPTNHAYSALKVSSPRLVSNRP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Humphray,S.J., (2004) Nature 429 (6990), 369-374 |
Description of Target |
TRIM14 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies and its function has not been determined. Four alternatively spliced transcript variants for this gene have been describedThe protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies and its function has not been determined. Four alternatively spliced transcript variants for this gene have been described. |
Protein Interactions |
RNF2; UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TRIM14 (ARP34860_P050) antibody |
Blocking Peptide |
For anti-TRIM14 (ARP34860_P050) antibody is Catalog # AAP34860 (Previous Catalog # AAPP06069) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TRIM14 |
Uniprot ID |
Q5TBQ8 |
Protein Name |
Tripartite motif-containing protein 14 |
Protein Accession # |
NP_150090 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_033221 |
Tested Species Reactivity |
Human |
Gene Symbol |
TRIM14 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human Liver
| WB Suggested Anti-TRIM14 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Liver |
|
|