| Product Number |
ARP34853_P050 |
| Product Page |
www.avivasysbio.com/znf614-antibody-n-terminal-region-arp34853-p050.html |
| Name |
ZNF614 Antibody - N-terminal region (ARP34853_P050) |
| Protein Size (# AA) |
585 amino acids |
| Molecular Weight |
67kDa |
| NCBI Gene Id |
80110 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 614 |
| Peptide Sequence |
Synthetic peptide located within the following region: VLSKLAHGQEPWTTDAKIQNKNCPGIGKVDSHLQEHSPNQRLLKSVQQCN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
ZNF614 is a new candidate transcription factor |
| Protein Interactions |
FAM9B; NFIX; RNF2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF614 (ARP34853_P050) antibody |
| Blocking Peptide |
For anti-ZNF614 (ARP34853_P050) antibody is Catalog # AAP34853 (Previous Catalog # AAPP06062) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF614 |
| Uniprot ID |
Q8N883 |
| Protein Name |
Zinc finger protein 614 |
| Protein Accession # |
NP_079316 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_025040 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF614 |
| Predicted Species Reactivity |
Human, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Horse: 79%; Human: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZNF614 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysate |
|
|
