PHF11 Antibody - middle region (ARP34848_P050)

• Product Number: ARP34848_P050
• Name: PHF11 Antibody - middle region (ARP34848_P050)
• Protein Size (# AA): 331 amino acids
• Molecular Weight: 37kDa
• NCBI Gene Id: 51131
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: PHD finger protein 11
• Alias Symbols: APY, BCAP, IGEL, IGER, IGHER, NYREN34, NY-REN-34
• Peptide Sequence: Synthetic peptide located within the following region: FSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Kimura,K., et al., (2006) Genome Res. 16 (1), 55-65
• Description of Target: PHF11 contains two PHD zinc fingers and probably regulates transcription. Distinctive splice variants were expressed in immune tissues and cells.
• Protein Interactions: MCPH1; LSM8; PIAS4; AGPAT2; CSNK2B;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PHF11 (ARP34848_P050) antibody is Catalog # AAP34848 (Previous Catalog # AAPP06057)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PHF11
• Uniprot ID: Q9UIL8
• Protein Name: PHD finger protein 11
• Sample Type Confirmation:

  PHF11 is supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_001035533
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001040443
• Tested Species Reactivity: Human
• Gene Symbol: PHF11
• Predicted Species Reactivity: Human, Dog
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Dog: 85%; Human: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-PHF11 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: HepG2 cell lysatePHF11 is supported by BioGPS gene expression data to be expressed in HepG2
• Image 2: Human Heart
  
  Rabbit Anti-PHF11 antibody
  Catalog Number: ARP34848
  Paraffin Embedded Tissue: Human Heart
  cell Cellular Data: cardiac cell
  Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X