| Product Number |
ARP34837_T100 |
| Product Page |
www.avivasysbio.com/hsf2bp-antibody-n-terminal-region-arp34837-t100.html |
| Name |
HSF2BP Antibody - N-terminal region (ARP34837_T100) |
| Protein Size (# AA) |
334 amino acids |
| Molecular Weight |
38kDa |
| NCBI Gene Id |
11077 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Heat shock transcription factor 2 binding protein |
| Alias Symbols |
POF19, MEILB2 |
| Peptide Sequence |
Synthetic peptide located within the following region: RHMGTKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGEVLESFQKLKIVE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Yoshima,T., et al., (1998) Gene 214 (1-2), 139-146 |
| Description of Target |
HSF2 binding protein (HSF2BP) associates with HSF2. The interaction occurs between the trimerization domain of HSF2 and the amino terminal hydrophilic region of HSF2BP that comprises two leucine zipper motifs. HSF2BP may therefore be involved in modulating HSF2 activation. |
| Protein Interactions |
UPF2; UBE2I; HSF2BP; CDC73; HSF2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HSF2BP (ARP34837_T100) antibody |
| Blocking Peptide |
For anti-HSF2BP (ARP34837_T100) antibody is Catalog # AAP34837 (Previous Catalog # AAPP06046) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human HSF2BP |
| Uniprot ID |
O75031 |
| Protein Name |
Heat shock factor 2-binding protein |
| Protein Accession # |
NP_008962 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_007031 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
HSF2BP |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100% |
| Image 1 | Human kidney
 | Human kidney |
|
| Image 2 | Human Jurkat
 | WB Suggested Anti-HSF2BP Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate |
|
