| Product Number |
ARP34806_P050 |
| Product Page |
www.avivasysbio.com/znf627-antibody-n-terminal-region-arp34806-p050.html |
| Name |
ZNF627 Antibody - N-terminal region (ARP34806_P050) |
| Protein Size (# AA) |
461 amino acids |
| Molecular Weight |
53kDa |
| NCBI Gene Id |
199692 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 627 |
| Peptide Sequence |
Synthetic peptide located within the following region: GKQWEDQNIEDPFKIPRRNISHIPERLCESKEGGQGEETFSQIPDGILNK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45 |
| Description of Target |
Located on chromosome 19, this gene encodes for zinc finger protein 627. |
| Protein Interactions |
CCNDBP1; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF627 (ARP34806_P050) antibody |
| Blocking Peptide |
For anti-ZNF627 (ARP34806_P050) antibody is Catalog # AAP34806 (Previous Catalog # AAPP06014) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF627 |
| Uniprot ID |
Q7L945 |
| Protein Name |
Zinc finger protein 627 |
| Protein Accession # |
NP_660338 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_145295 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF627 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZNF627 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate |
|
|
