HS747E2A Antibody - middle region (ARP34804_T100)

Data Sheet
 
Product Number ARP34804_T100
Product Page www.avivasysbio.com/hs747e2a-antibody-middle-region-arp34804-t100.html
Name HS747E2A Antibody - middle region (ARP34804_T100)
Protein Size (# AA) 290 amino acids
Molecular Weight 33kDa
NCBI Gene Id 25770
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Chromosome 22 open reading frame 31
Alias Symbols HS747E2A, bK747E2.1
Peptide Sequence Synthetic peptide located within the following region: MKATQQARKRNFISSKSKQPAGHRRPAGGIRESKESSKEKKLTVRQDLED
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Collins,J.E., et al., (2004) Genome Biol. 5(10), R84
Description of Target The gene encoding the hypothetical protein HS747E2A is located on chromosome 22.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-C22orf31 (ARP34804_T100) antibody
Blocking Peptide For anti-C22orf31 (ARP34804_T100) antibody is Catalog # AAP34804 (Previous Catalog # AAPP06012)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human HS747E2A
Uniprot ID O95567
Protein Name Uncharacterized protein C22orf31
Protein Accession # NP_056185
Purification Protein A purified
Nucleotide Accession # NM_015370
Tested Species Reactivity Human
Gene Symbol C22orf31
Predicted Species Reactivity Human, Cow, Dog, Horse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 92%; Horse: 92%; Human: 100%; Pig: 92%
Image 1
Human HepG2
WB Suggested Anti-HS747E2A Antibody Titration: 1.25ug/ml
ELISA Titer: 1:500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com