Product Number |
ARP34804_T100 |
Product Page |
www.avivasysbio.com/hs747e2a-antibody-middle-region-arp34804-t100.html |
Name |
HS747E2A Antibody - middle region (ARP34804_T100) |
Protein Size (# AA) |
290 amino acids |
Molecular Weight |
33kDa |
NCBI Gene Id |
25770 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Chromosome 22 open reading frame 31 |
Alias Symbols |
HS747E2A, bK747E2.1 |
Peptide Sequence |
Synthetic peptide located within the following region: MKATQQARKRNFISSKSKQPAGHRRPAGGIRESKESSKEKKLTVRQDLED |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Collins,J.E., et al., (2004) Genome Biol. 5(10), R84 |
Description of Target |
The gene encoding the hypothetical protein HS747E2A is located on chromosome 22. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-C22orf31 (ARP34804_T100) antibody |
Blocking Peptide |
For anti-C22orf31 (ARP34804_T100) antibody is Catalog # AAP34804 (Previous Catalog # AAPP06012) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human HS747E2A |
Uniprot ID |
O95567 |
Protein Name |
Uncharacterized protein C22orf31 |
Protein Accession # |
NP_056185 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_015370 |
Tested Species Reactivity |
Human |
Gene Symbol |
C22orf31 |
Predicted Species Reactivity |
Human, Cow, Dog, Horse, Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 92%; Horse: 92%; Human: 100%; Pig: 92% |
Image 1 | Human HepG2
| WB Suggested Anti-HS747E2A Antibody Titration: 1.25ug/ml ELISA Titer: 1:500 Positive Control: HepG2 cell lysate |
|
|