| Product Number |
ARP34782_P050 |
| Product Page |
www.avivasysbio.com/tcf7-antibody-middle-region-arp34782-p050.html |
| Name |
TCF7 Antibody - middle region (ARP34782_P050) |
| Protein Size (# AA) |
384 amino acids |
| Molecular Weight |
42kDa |
| NCBI Gene Id |
6932 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Transcription factor 7 (T-cell specific, HMG-box) |
| Alias Symbols |
TCF-1 |
| Peptide Sequence |
Synthetic peptide located within the following region: PAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFM |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Smit,L., et al., (2004) J. Biol. Chem. 279 (17), 17232-17240 |
| Description of Target |
The T-cell-specific transcription factor TCF7 activates genes involved in immune regulation and is a candidate locus for genetic susceptibility to type 1 diabetes. |
| Protein Interactions |
UBC; SS18L1; DAZAP2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TCF7 (ARP34782_P050) antibody |
| Blocking Peptide |
For anti-TCF7 (ARP34782_P050) antibody is Catalog # AAP34782 (Previous Catalog # AAPP05976) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TCF7 |
| Uniprot ID |
Q86WR9 |
| Protein Name |
Transcription factor 7 |
| Protein Accession # |
NP_003193 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003202 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TCF7 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 100%; Yeast: 81% |
| Image 1 | Human kidney
 | Human kidney |
| | Image 2 | Human Thymus
 | WB Suggested Anti-TCF7 Antibody Titration: 0.125ug/ml
ELISA Titer: 1:62500
Positive Control: Human Thymus |
|
|
