TCF7 Antibody - N-terminal region (ARP34781_P050)

Data Sheet
 
Product Number ARP34781_P050
Product Page www.avivasysbio.com/tcf7-antibody-n-terminal-region-arp34781-p050.html
Name TCF7 Antibody - N-terminal region (ARP34781_P050)
Protein Size (# AA) 269 amino acids
Molecular Weight 30kDa
NCBI Gene Id 6932
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Transcription factor 7 (T-cell specific, HMG-box)
Alias Symbols TCF-1
Peptide Sequence Synthetic peptide located within the following region: PQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQKQVHRPLQTP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Smit,L., et al., (2004) J. Biol. Chem. 279 (17), 17232-17240
Description of Target The T-cell-specific transcription factor TCF7 activates genes involved in immune regulation and is a candidate locus for genetic susceptibility to type 1 diabetes.
Protein Interactions UBC; SS18L1; DAZAP2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TCF7 (ARP34781_P050) antibody
Blocking Peptide For anti-TCF7 (ARP34781_P050) antibody is Catalog # AAP34781 (Previous Catalog # AAPP05975)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TCF7
Uniprot ID P36402-2
Protein Name Transcription factor 7
Sample Type Confirmation

TCF7 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_963963
Purification Affinity Purified
Nucleotide Accession # NM_201632
Tested Species Reactivity Human, Mouse
Gene Symbol TCF7
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Image 1
Mouse Testis
Host: Mouse
Target Name: TCF7
Sample Tissue: Mouse Testis
Antibody Dilution: 1ug/ml
Image 2
Human Jurkat
WB Suggested Anti-TCF7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysateTCF7 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com