Product Number |
ARP34781_P050 |
Product Page |
www.avivasysbio.com/tcf7-antibody-n-terminal-region-arp34781-p050.html |
Name |
TCF7 Antibody - N-terminal region (ARP34781_P050) |
Protein Size (# AA) |
269 amino acids |
Molecular Weight |
30kDa |
NCBI Gene Id |
6932 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Transcription factor 7 (T-cell specific, HMG-box) |
Alias Symbols |
TCF-1 |
Peptide Sequence |
Synthetic peptide located within the following region: PQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQKQVHRPLQTP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Smit,L., et al., (2004) J. Biol. Chem. 279 (17), 17232-17240 |
Description of Target |
The T-cell-specific transcription factor TCF7 activates genes involved in immune regulation and is a candidate locus for genetic susceptibility to type 1 diabetes. |
Protein Interactions |
UBC; SS18L1; DAZAP2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TCF7 (ARP34781_P050) antibody |
Blocking Peptide |
For anti-TCF7 (ARP34781_P050) antibody is Catalog # AAP34781 (Previous Catalog # AAPP05975) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TCF7 |
Uniprot ID |
P36402-2 |
Protein Name |
Transcription factor 7 |
Sample Type Confirmation |
TCF7 is strongly supported by BioGPS gene expression data to be expressed in Jurkat |
Protein Accession # |
NP_963963 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_201632 |
Tested Species Reactivity |
Human, Mouse |
Gene Symbol |
TCF7 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
Image 1 | Mouse Testis
| Host: Mouse Target Name: TCF7 Sample Tissue: Mouse Testis Antibody Dilution: 1ug/ml |
|
Image 2 | Human Jurkat
| WB Suggested Anti-TCF7 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysateTCF7 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells |
|