Thra Antibody - C-terminal region (ARP34779_P050)

Data Sheet
 
Product Number ARP34779_P050
Product Page www.avivasysbio.com/thra-antibody-c-terminal-region-arp34779-p050.html
Name Thra Antibody - C-terminal region (ARP34779_P050)
Protein Size (# AA) 492 amino acids
Molecular Weight 55kDa
NCBI Gene Id 81812
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Thyroid hormone receptor alpha
Alias Symbols ERBA1, Thra1, c-erbA-1
Peptide Sequence Synthetic peptide located within the following region: MSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNIPHFWPKLLMKVTDL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Thra binds the promoter of the Na+/H+ exchanger NHE1 and mediates thyroid hormone induced transcriptional activation.
Protein Interactions Pik3r1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-Thra (ARP34779_P050) antibody
Blocking Peptide For anti-Thra (ARP34779_P050) antibody is Catalog # AAP34779 (Previous Catalog # AAPP23669)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Rat
Uniprot ID P63059
Protein Name Thyroid hormone receptor alpha
Protein Accession # NP_001017960
Purification Affinity Purified
Nucleotide Accession # NM_001017960
Tested Species Reactivity Rat
Gene Symbol Thra
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 79%
Image 1
Rat Muscle
WB Suggested Anti-Thra Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Muscle
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com