Product Number |
ARP34775_P050 |
Product Page |
www.avivasysbio.com/foxk2-antibody-middle-region-arp34775-p050.html |
Name |
FOXK2 Antibody - middle region (ARP34775_P050) |
Protein Size (# AA) |
660 amino acids |
Molecular Weight |
69kDa |
NCBI Gene Id |
3607 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Forkhead box K2 |
Alias Symbols |
ILF, ILF1, ILF-1, nGTBP |
Peptide Sequence |
Synthetic peptide located within the following region: ANTYTVSGQAVVTPAAVLAPPKAEAQENGDHREVKVKVEPIPAIGHATLG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Liu,P.P., et al., (2002) Proteins 49 (4), 543-553 |
Description of Target |
FOXK2 contains a fork head DNA binding domain. This protein can bind to the purine-rich motifs of the HIV long terminal repeat (LTR), and to the similar purine-rich motif in the interleukin 2 (IL2) promoter. It may be involved in the regulation of viral and cellular promoter elements. Three alternatively spliced transcript variants encoding distinct isoforms have been described.The protein encoded by this gene contains a fork head DNA binding domain. This protein can bind to the purine-rich motifs of the HIV long terminal repeat (LTR), and to the similar purine-rich motif in the interleukin 2 (IL2) promoter. It may be involved in the regulation of viral and cellular promoter elements. Three alternatively spliced transcript variants encoding distinct isoforms have been described. |
Protein Interactions |
HECW2; SOX2; CBX6; SUMO2; BAP1; IRF2; AMOT; IL2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-FOXK2 (ARP34775_P050) antibody |
Blocking Peptide |
For anti-FOXK2 (ARP34775_P050) antibody is Catalog # AAP34775 (Previous Catalog # AAPP05969) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human FOXK2 |
Uniprot ID |
Q01167 |
Protein Name |
Forkhead box protein K2 |
Publications |
Komorek, J. et al. Adenovirus type 5 E1A and E6 proteins of low-risk cutaneous beta-human papillomaviruses suppress cell transformation through interaction with FOXK1/K2 transcription factors. J. Virol. 84, 2719-31 (2010). 20053746 |
Sample Type Confirmation |
FOXK2 is supported by BioGPS gene expression data to be expressed in 721_B, HepG2 |
Protein Accession # |
NP_004505 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_004514 |
Tested Species Reactivity |
Human |
Gene Symbol |
FOXK2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 91%; Pig: 93%; Rabbit: 79%; Rat: 91% |
Image 1 | Human 721_B
| Host: Rabbit Target Name: FOXK2 Sample Type: 721_B Antibody Dilution: 1.0ug/mlFOXK2 is supported by BioGPS gene expression data to be expressed in 721_B |
|
Image 2 | Human HepG2
| WB Suggested Anti-FOXK2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:12500 Positive Control: HepG2 cell lysateFOXK2 is supported by BioGPS gene expression data to be expressed in HepG2 |
|
Image 3 | Human Bronchial Epithelial Tissue
| Rabbit Anti-FOXK2 Antibody Catalog Number: ARP34775_P050 Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Nuclear in perinuclear/nuclear Membrane Primary Antibody Concentration: 1:100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
|
|
Image 4 | Human A549 Whole Cell
| Host: Rabbit Target Name: FOXK2 Sample Tissue: Human A549 Whole Cell Antibody Dilution: 1ug/ml |
|
Image 5 | Human 786-0 Whole Cell
| Host: Rabbit Target Name: FOXK2 Sample Tissue: Human 786-0 Whole Cell Antibody Dilution: 3ug/ml |
|