FOXK2 Antibody - middle region (ARP34775_P050)

Data Sheet
 
Product Number ARP34775_P050
Product Page www.avivasysbio.com/foxk2-antibody-middle-region-arp34775-p050.html
Name FOXK2 Antibody - middle region (ARP34775_P050)
Protein Size (# AA) 660 amino acids
Molecular Weight 69kDa
NCBI Gene Id 3607
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Forkhead box K2
Alias Symbols ILF, ILF1, ILF-1, nGTBP
Peptide Sequence Synthetic peptide located within the following region: ANTYTVSGQAVVTPAAVLAPPKAEAQENGDHREVKVKVEPIPAIGHATLG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Liu,P.P., et al., (2002) Proteins 49 (4), 543-553
Description of Target FOXK2 contains a fork head DNA binding domain. This protein can bind to the purine-rich motifs of the HIV long terminal repeat (LTR), and to the similar purine-rich motif in the interleukin 2 (IL2) promoter. It may be involved in the regulation of viral and cellular promoter elements. Three alternatively spliced transcript variants encoding distinct isoforms have been described.The protein encoded by this gene contains a fork head DNA binding domain. This protein can bind to the purine-rich motifs of the HIV long terminal repeat (LTR), and to the similar purine-rich motif in the interleukin 2 (IL2) promoter. It may be involved in the regulation of viral and cellular promoter elements. Three alternatively spliced transcript variants encoding distinct isoforms have been described.
Protein Interactions HECW2; SOX2; CBX6; SUMO2; BAP1; IRF2; AMOT; IL2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-FOXK2 (ARP34775_P050) antibody
Blocking Peptide For anti-FOXK2 (ARP34775_P050) antibody is Catalog # AAP34775 (Previous Catalog # AAPP05969)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human FOXK2
Uniprot ID Q01167
Protein Name Forkhead box protein K2
Publications

Komorek, J. et al. Adenovirus type 5 E1A and E6 proteins of low-risk cutaneous beta-human papillomaviruses suppress cell transformation through interaction with FOXK1/K2 transcription factors. J. Virol. 84, 2719-31 (2010). 20053746

Sample Type Confirmation

FOXK2 is supported by BioGPS gene expression data to be expressed in 721_B, HepG2

Protein Accession # NP_004505
Purification Affinity Purified
Nucleotide Accession # NM_004514
Tested Species Reactivity Human
Gene Symbol FOXK2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 91%; Pig: 93%; Rabbit: 79%; Rat: 91%
Image 1
Human 721_B
Host: Rabbit
Target Name: FOXK2
Sample Type: 721_B
Antibody Dilution: 1.0ug/mlFOXK2 is supported by BioGPS gene expression data to be expressed in 721_B
Image 2
Human HepG2
WB Suggested Anti-FOXK2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysateFOXK2 is supported by BioGPS gene expression data to be expressed in HepG2
Image 3
Human Bronchial Epithelial Tissue
Rabbit Anti-FOXK2 Antibody
Catalog Number: ARP34775_P050
Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue
Observed Staining: Nuclear in perinuclear/nuclear Membrane
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
Image 4
Human A549 Whole Cell
Host: Rabbit
Target Name: FOXK2
Sample Tissue: Human A549 Whole Cell
Antibody Dilution: 1ug/ml
Image 5
Human 786-0 Whole Cell
Host: Rabbit
Target Name: FOXK2
Sample Tissue: Human 786-0 Whole Cell
Antibody Dilution: 3ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com