HOXA1 Antibody - middle region (ARP34773_T100)

Data Sheet
 
Product Number ARP34773_T100
Product Page www.avivasysbio.com/hoxa1-antibody-middle-region-arp34773-t100.html
Name HOXA1 Antibody - middle region (ARP34773_T100)
Protein Size (# AA) 132 amino acids
Molecular Weight 14kDa
NCBI Gene Id 3198
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Homeobox A1
Alias Symbols BSAS, HOX1, HOX1F
Peptide Sequence Synthetic peptide located within the following region: NLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADPPRSLSLPRIGDIFSS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Conciatori,M., et al., (2004) Biol. Psychiatry 55 (4), 413-419
Description of Target In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA1 is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. The encoded protein may be involved in the placement of hindbrain segments in the proper location along the anterior-posterior axis during development.
Protein Interactions KRTAP26-1; NOTCH2NL; KRTAP12-4; KRTAP10-3; KRTAP10-8; KRTAP4-11; KRTAP10-5; KRTAP10-11; KRTAP10-1; KRTAP10-9; TBC1D10C; KRTAP12-1; KRTAP12-2; LCE3E; LCE1B; TRIM42; LCE4A; MGAT5B; KRT40; KRTAP4-2; KRTAP4-7; KRTAP9-4; KRTAP9-2; KRTAP3-2; KRTAP4-12; CCDC33;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HOXA1 (ARP34773_T100) antibody
Blocking Peptide For anti-HOXA1 (ARP34773_T100) antibody is Catalog # AAP34773 (Previous Catalog # AAPP05967)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human HOXA1
Uniprot ID P49639-2
Protein Name Homeobox protein Hox-A1
Protein Accession # NP_705873
Purification Protein A purified
Nucleotide Accession # NM_153620
Tested Species Reactivity Human
Gene Symbol HOXA1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 92%; Rat: 92%
Image 1
Human Jurkat
WB Suggested Anti-HOXA1 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Image 2
Human Brain
Human Brain
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com