Product Number |
ARP34773_T100 |
Product Page |
www.avivasysbio.com/hoxa1-antibody-middle-region-arp34773-t100.html |
Name |
HOXA1 Antibody - middle region (ARP34773_T100) |
Protein Size (# AA) |
132 amino acids |
Molecular Weight |
14kDa |
NCBI Gene Id |
3198 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Homeobox A1 |
Alias Symbols |
BSAS, HOX1, HOX1F |
Peptide Sequence |
Synthetic peptide located within the following region: NLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADPPRSLSLPRIGDIFSS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Conciatori,M., et al., (2004) Biol. Psychiatry 55 (4), 413-419 |
Description of Target |
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA1 is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. The encoded protein may be involved in the placement of hindbrain segments in the proper location along the anterior-posterior axis during development. |
Protein Interactions |
KRTAP26-1; NOTCH2NL; KRTAP12-4; KRTAP10-3; KRTAP10-8; KRTAP4-11; KRTAP10-5; KRTAP10-11; KRTAP10-1; KRTAP10-9; TBC1D10C; KRTAP12-1; KRTAP12-2; LCE3E; LCE1B; TRIM42; LCE4A; MGAT5B; KRT40; KRTAP4-2; KRTAP4-7; KRTAP9-4; KRTAP9-2; KRTAP3-2; KRTAP4-12; CCDC33; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-HOXA1 (ARP34773_T100) antibody |
Blocking Peptide |
For anti-HOXA1 (ARP34773_T100) antibody is Catalog # AAP34773 (Previous Catalog # AAPP05967) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human HOXA1 |
Uniprot ID |
P49639-2 |
Protein Name |
Homeobox protein Hox-A1 |
Protein Accession # |
NP_705873 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_153620 |
Tested Species Reactivity |
Human |
Gene Symbol |
HOXA1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 92%; Rat: 92% |
Image 1 | Human Jurkat
| WB Suggested Anti-HOXA1 Antibody Titration: 2.5ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysate |
| Image 2 | Human Brain
| Human Brain |
|
|