RNF36 Antibody - N-terminal region (ARP34765_P050)

Data Sheet
 
Product Number ARP34765_P050
Product Page www.avivasysbio.com/rnf36-antibody-n-terminal-region-arp34765-p050.html
Name RNF36 Antibody - N-terminal region (ARP34765_P050)
Protein Size (# AA) 361 amino acids
Molecular Weight 41kDa
NCBI Gene Id 140691
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Tripartite motif containing 69
Alias Symbols Trif, HSD34, RNF36, HSD-34
Peptide Sequence Synthetic peptide located within the following region: SIQAKTEQQNSFDFLKDITTLLHSLEQGMKVLATRELISRKLNLGQYKGP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Shyu,H.W., et al., (2003) Exp. Cell Res. 287 (2), 301-313
Description of Target RNF36 is specifically expressed in germ cells at round spermatid stages during spermatogenesis. The protein encoded by this gene contains an N-terminal RING finger motif, a B-box, and a C-terminal B-30.2-like domain. When overexpressed in COS-7 and HEK-293 cells, this protein was shown to induce cell apoptosis.
Protein Interactions IYD; NEK8; PPP1R18; SYNE4; ZNF483; TRIM69; HAUS1; FAM110A; LARP1B; TRIM44; RSPH14; SF3A3; RECK; SF1; MAGEA4; KRT17; FKBP1B; DVL1; ATP5G1; ASNS; BAG3; APP; TLR9; TLR4; TLR3; SKIL; PML;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TRIM69 (ARP34765_P050) antibody
Blocking Peptide For anti-TRIM69 (ARP34765_P050) antibody is Catalog # AAP34765 (Previous Catalog # AAPP05959)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human RNF36
Uniprot ID Q8IYY3
Protein Name Tripartite motif-containing protein 69
Protein Accession # NP_892030
Purification Affinity Purified
Nucleotide Accession # NM_182985
Tested Species Reactivity Human
Gene Symbol TRIM69
Predicted Species Reactivity Human, Mouse, Rat, Cow, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Horse: 79%; Human: 100%; Mouse: 85%; Pig: 86%; Rabbit: 79%; Rat: 85%
Image 1
Human Jurkat
WB Suggested Anti-RNF36 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com