GRLF1 Antibody - N-terminal region (ARP34758_P050)

Data Sheet
 
Product Number ARP34758_P050
Product Page www.avivasysbio.com/grlf1-antibody-n-terminal-region-arp34758-p050.html
Name GRLF1 Antibody - N-terminal region (ARP34758_P050)
Protein Size (# AA) 1499 amino acids
Molecular Weight 171kDa
NCBI Gene Id 2909
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Rho GTPase activating protein 35
Alias Symbols GRF-1, GRLF1, P190A, P190-A, p190RhoGAP, p190ARhoGAP
Peptide Sequence Synthetic peptide located within the following region: RPSADEFHLDHTSVLSTSDFGGRVVNNDHFLYWGEVSRSLEDCVECKMHI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of this protein remains unknown.
Protein Interactions KRT31; RASA1; RND1; RND2; RND3; UBC; HDAC1; BCL6; RHOA; SRC; PTPRZ1; GRB2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ARHGAP35 (ARP34758_P050) antibody
Blocking Peptide For anti-ARHGAP35 (ARP34758_P050) antibody is Catalog # AAP34758 (Previous Catalog # AAPP05952)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GRLF1
Uniprot ID B2RTN5
Protein Name Glucocorticoid receptor DNA binding factor 1 EMBL AAI39462.1
Protein Accession # NP_077318
Purification Affinity Purified
Nucleotide Accession # NM_024342
Tested Species Reactivity Human
Gene Symbol ARHGAP35
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human HeLa
WB Suggested Anti-GRLF1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com