PSIP1 Antibody - N-terminal region (ARP34753_T100)

Data Sheet
 
Product Number ARP34753_T100
Product Page www.avivasysbio.com/psip1-antibody-n-terminal-region-arp34753-t100.html
Name PSIP1 Antibody - N-terminal region (ARP34753_T100)
Protein Size (# AA) 333 amino acids
Molecular Weight 38kDa
NCBI Gene Id 11168
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name PC4 and SFRS1 interacting protein 1
Alias Symbols p52, p75, PAIP, DFS70, LEDGF, PSIP2
Peptide Sequence Synthetic peptide located within the following region: DNNPKVKFSSQQAATKQSNASSDVEVEEKETSVSKEDTDHEEKASNEDVT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Vandegraaff,N., (2006) Virology 346 (2), 415-426
Description of Target PSIP1 encodes a multidomain adaptor protein that interacts with the nuclear import apparatus, lentiviral IN proteins and chromatin by means of an NLS, an IBD and additional chromatin-interacting domains.
Protein Interactions PPP2R1A; UBC; RPA3; RPA2; RPA1; HMGA2; HMGA1; WHSC1; CSNK2A1; gag-pol; ESR1; ZC3H18; FTSJ3; EXOSC5; EXOSC4; NCSTN; RRS1; SUPT16H; SAP18; THRAP3; EIF4A3; U2AF1; TPBG; SON; TRA2B; RPS24; RPS11; RPL6; CAST; SH3KBP1; MEN1; SUMO1; SUMO2; HDGF; MAPK6; KMT2A; BA
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PSIP1 (ARP34753_T100) antibody
Blocking Peptide For anti-PSIP1 (ARP34753_T100) antibody is Catalog # AAP34753 (Previous Catalog # AAPP23666)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PSIP1
Uniprot ID O75475-2
Protein Name PC4 and SFRS1-interacting protein
Protein Accession # NP_066967
Purification Protein A purified
Nucleotide Accession # NM_021144
Tested Species Reactivity Human
Gene Symbol PSIP1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 93%; Sheep: 100%
Image 1
Human HepG2
WB Suggested Anti-PSIP1 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com