| Product Number |
ARP34738_T100 |
| Product Page |
www.avivasysbio.com/trim14-antibody-n-terminal-region-arp34738-t100.html |
| Name |
TRIM14 Antibody - N-terminal region (ARP34738_T100) |
| Protein Size (# AA) |
442 amino acids |
| Molecular Weight |
50kDa |
| NCBI Gene Id |
9830 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Tripartite motif containing 14 |
| Peptide Sequence |
Synthetic peptide located within the following region: TELRLLLDEEEALAKKFIDKNTQLTLQVYREQADSCREQLDIMNDLSNRV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Reymond,A., (2001) EMBO J. 20 (9), 2140-2151 |
| Description of Target |
The protein encoded byTRIM14 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies and its function has not been determined. Four alternatively spliced transcript variants for this gene have been described.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies and its function has not been determined. Four alternatively spliced transcript variants for this gene have been described. |
| Protein Interactions |
RNF2; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TRIM14 (ARP34738_T100) antibody |
| Blocking Peptide |
For anti-TRIM14 (ARP34738_T100) antibody is Catalog # AAP34738 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM14 |
| Uniprot ID |
Q14142 |
| Protein Name |
Tripartite motif-containing protein 14 |
| Sample Type Confirmation |
TRIM14 is strongly supported by BioGPS gene expression data to be expressed in Jurkat |
| Protein Accession # |
NP_055603 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_014788 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TRIM14 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 93% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-TRIM14 Antibody
Titration: 2.5 ug/ml
Positive Control: Jurkat Whole CellTRIM14 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells |
|
