| Product Number |
ARP34738_P050 |
| Product Page |
www.avivasysbio.com/trim14-antibody-n-terminal-region-arp34738-p050.html |
| Name |
TRIM14 Antibody - N-terminal region (ARP34738_P050) |
| Protein Size (# AA) |
253 amino acids |
| Molecular Weight |
28kDa |
| NCBI Gene Id |
9830 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Tripartite motif containing 14 |
| Peptide Sequence |
Synthetic peptide located within the following region: TELRLLLDEEEALAKKFIDKNTQLTLQVYREQADSCREQLDIMNDLSNRV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Reymond,A., et al., (2001) EMBO J. 20 (9), 2140-2151 |
| Description of Target |
The protein encoded byTRIM14 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies and its function has not been determined. Four alternatively spliced transcript variants for this gene have been described. |
| Protein Interactions |
RNF2; UBC; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TRIM14 (ARP34738_P050) antibody |
| Blocking Peptide |
For anti-TRIM14 (ARP34738_P050) antibody is Catalog # AAP34738 (Previous Catalog # AAPP05932) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM14 |
| Uniprot ID |
Q5TBQ8 |
| Protein Name |
Tripartite motif-containing protein 14 |
| Sample Type Confirmation |
TRIM14 is strongly supported by BioGPS gene expression data to be expressed in Jurkat |
| Protein Accession # |
NP_150090 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_033221 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TRIM14 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 93% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-TRIM14 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysateTRIM14 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells |
|
