| Product Number |
ARP34736_T100 |
| Product Page |
www.avivasysbio.com/rims3-antibody-c-terminal-region-arp34736-t100.html |
| Name |
RIMS3 Antibody - C-terminal region (ARP34736_T100) |
| Protein Size (# AA) |
308 amino acids |
| Molecular Weight |
33kDa |
| NCBI Gene Id |
9783 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Regulating synaptic membrane exocytosis 3 |
| Alias Symbols |
NIM3, RIM3, RIM 3 |
| Peptide Sequence |
Synthetic peptide located within the following region: IMLDELDLSAAVTGWYKLFPTSSVADSTLGSLTRRLSQSSLESATSPSCS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Wang,Y. et al., (2003) Genomics 81 (2), 126-137 |
| Description of Target |
RIMS3 belongs to a family of synaptic proteins that are essential for normal neurotransmitter release. |
| Protein Interactions |
BANP; GJA5; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RIMS3 (ARP34736_T100) antibody |
| Blocking Peptide |
For anti-RIMS3 (ARP34736_T100) antibody is Catalog # AAP34736 (Previous Catalog # AAPP05930) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human RIMS3 |
| Uniprot ID |
Q9UJD0 |
| Protein Name |
Regulating synaptic membrane exocytosis protein 3 |
| Sample Type Confirmation |
RIMS3 is strongly supported by BioGPS gene expression data to be expressed in Jurkat |
| Protein Accession # |
NP_055562 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_014747 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
RIMS3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-RIMS3 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysateRIMS3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells |
|
| Image 2 | Human kidney
 | Human kidney |
|
| Image 3 | Mouse Pancreas
 | Host: Mouse
Target Name: RIMS3
Sample Tissue: Mouse Pancreas
Antibody Dilution: 1ug/ml |
|
