LRRC14 Antibody - C-terminal region (ARP34712_P050)

Data Sheet
 
Product Number ARP34712_P050
Product Page www.avivasysbio.com/lrrc14-antibody-c-terminal-region-arp34712-p050.html
Name LRRC14 Antibody - C-terminal region (ARP34712_P050)
Protein Size (# AA) 493 amino acids
Molecular Weight 55kDa
NCBI Gene Id 9684
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Leucine rich repeat containing 14
Alias Symbols LRRC14A
Peptide Sequence Synthetic peptide located within the following region: ELLRDSVAQAELRTVVHPFPVDCYEGLPWPPPASVLLEASINEEKFARVE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ohara,O., Unpublished (1993)
Description of Target LRRC14 belongs to the PRAME family and contains 6 LRR (leucine-rich) repeats
Protein Interactions COPS6; RBX1; COPS3; CUL2; TCEB2; TCEB1; COPS4; COPS5; UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-LRRC14 (ARP34712_P050) antibody
Blocking Peptide For anti-LRRC14 (ARP34712_P050) antibody is Catalog # AAP34712 (Previous Catalog # AAPP05906)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human LRRC14
Uniprot ID Q15048
Protein Name Leucine-rich repeat-containing protein 14
Protein Accession # NP_055480
Purification Affinity Purified
Nucleotide Accession # NM_014665
Tested Species Reactivity Human
Gene Symbol LRRC14
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93%
Image 1
Human HepG2
WB Suggested Anti-LRRC14 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com