Product Number |
ARP34712_P050 |
Product Page |
www.avivasysbio.com/lrrc14-antibody-c-terminal-region-arp34712-p050.html |
Name |
LRRC14 Antibody - C-terminal region (ARP34712_P050) |
Protein Size (# AA) |
493 amino acids |
Molecular Weight |
55kDa |
NCBI Gene Id |
9684 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Leucine rich repeat containing 14 |
Alias Symbols |
LRRC14A |
Peptide Sequence |
Synthetic peptide located within the following region: ELLRDSVAQAELRTVVHPFPVDCYEGLPWPPPASVLLEASINEEKFARVE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ohara,O., Unpublished (1993) |
Description of Target |
LRRC14 belongs to the PRAME family and contains 6 LRR (leucine-rich) repeats |
Protein Interactions |
COPS6; RBX1; COPS3; CUL2; TCEB2; TCEB1; COPS4; COPS5; UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-LRRC14 (ARP34712_P050) antibody |
Blocking Peptide |
For anti-LRRC14 (ARP34712_P050) antibody is Catalog # AAP34712 (Previous Catalog # AAPP05906) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human LRRC14 |
Uniprot ID |
Q15048 |
Protein Name |
Leucine-rich repeat-containing protein 14 |
Protein Accession # |
NP_055480 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_014665 |
Tested Species Reactivity |
Human |
Gene Symbol |
LRRC14 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93% |
Image 1 | Human HepG2
| WB Suggested Anti-LRRC14 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysate |
|
|