TRIM27 Antibody - middle region (ARP34700_P050)

Data Sheet
 
Product Number ARP34700_P050
Product Page www.avivasysbio.com/trim27-antibody-middle-region-arp34700-p050.html
Name TRIM27 Antibody - middle region (ARP34700_P050)
Protein Size (# AA) 358 amino acids
Molecular Weight 41kDa
NCBI Gene Id 5987
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Tripartite motif containing 27
Alias Symbols RFP, RNF76
Peptide Sequence Synthetic peptide located within the following region: EQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMEREKIVWEFEQLY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target TRIM27 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to the nuclear matrix. It interacts with the enhancer of polycomb protein and represses gene transcription. It is also thought to be involved in the differentiation of male germ cells. Fusion of the N-terminus of this protein with the truncated C-terminus of the RET gene product has been shown to result in production of the ret transforming protein.
Protein Interactions LGALS14; FAM214A; USE1; CCDC94; ZNF446; TBC1D22B; ABCF3; RBM41; CCDC87; C14orf105; RBM23; WDYHV1; CHCHD3; KCTD9; FAM193B; CCHCR1; FAM64A; FBXW5; ZNF581; AMOTL2; WT1-AS; SLC15A3; CDKL3; VPS28; MEMO1; TPRKB; ARHGEF3; NME7; BABAM1; MAT2B; INPP5J; FOXB1; CDK1
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TRIM27 (ARP34700_P050) antibody
Blocking Peptide For anti-TRIM27 (ARP34700_P050) antibody is Catalog # AAP34700 (Previous Catalog # AAPP23649)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TRIM27
Uniprot ID Q5RJA8
Protein Name Zinc finger protein RFP
Protein Accession # NP_112212
Purification Affinity Purified
Nucleotide Accession # NM_030950
Tested Species Reactivity Human
Gene Symbol TRIM27
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 92%
Image 1
Transfected 293T
WB Suggested Anti-TRIM27 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com