Product Number |
ARP34677_T100 |
Product Page |
www.avivasysbio.com/klhl14-antibody-n-terminal-region-arp34677-t100.html |
Name |
KLHL14 Antibody - N-terminal region (ARP34677_T100) |
Protein Size (# AA) |
628 amino acids |
Molecular Weight |
71kDa |
NCBI Gene Id |
57565 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Kelch-like 14 (Drosophila) |
Peptide Sequence |
Synthetic peptide located within the following region: MSRSGDRTSTFDPSHSDNLLHGLNLLWRKQLFCDVTLTAQGQQFHCHKAV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ohara,O., et al., Unpublished (2000) |
Description of Target |
KLHL14 is a member of the KLHL family. |
Protein Interactions |
TOR1A; HSP90AA1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-KLHL14 (ARP34677_T100) antibody |
Blocking Peptide |
For anti-KLHL14 (ARP34677_T100) antibody is Catalog # AAP34677 (Previous Catalog # AAPP05867) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human KLHL14 |
Uniprot ID |
Q8WU41 |
Protein Name |
Kelch-like protein 14 |
Protein Accession # |
NP_065856 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_020805 |
Tested Species Reactivity |
Human |
Gene Symbol |
KLHL14 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
Image 1 | Human HepG2
| WB Suggested Anti-KLHL14 Antibody Titration: 5.0ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysate |
|
|