KLHL14 Antibody - N-terminal region (ARP34677_T100)

Data Sheet
 
Product Number ARP34677_T100
Product Page www.avivasysbio.com/klhl14-antibody-n-terminal-region-arp34677-t100.html
Name KLHL14 Antibody - N-terminal region (ARP34677_T100)
Protein Size (# AA) 628 amino acids
Molecular Weight 71kDa
NCBI Gene Id 57565
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Kelch-like 14 (Drosophila)
Peptide Sequence Synthetic peptide located within the following region: MSRSGDRTSTFDPSHSDNLLHGLNLLWRKQLFCDVTLTAQGQQFHCHKAV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ohara,O., et al., Unpublished (2000)
Description of Target KLHL14 is a member of the KLHL family.
Protein Interactions TOR1A; HSP90AA1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KLHL14 (ARP34677_T100) antibody
Blocking Peptide For anti-KLHL14 (ARP34677_T100) antibody is Catalog # AAP34677 (Previous Catalog # AAPP05867)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human KLHL14
Uniprot ID Q8WU41
Protein Name Kelch-like protein 14
Protein Accession # NP_065856
Purification Protein A purified
Nucleotide Accession # NM_020805
Tested Species Reactivity Human
Gene Symbol KLHL14
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Image 1
Human HepG2
WB Suggested Anti-KLHL14 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com